RL26_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RL26_SCHPO
• UniProt AC: P78946
• Protein Name: 60S ribosomal protein L26
• Gene Name: rpl26
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 126
• Protein Sequence: MKFSRDVTSSRRKQRKAHFGAPSSVRRVLMSAPLSKELREQYKIRSLPVRRDDQITVIRGSNKGREGKITSVYRKKFLLLIERVTREKANGASAPVGIDASKVVITKLHLDKDRKDLIVRKGGKVE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
23	Phosphorylation	KAHFGAPSSVRRVLM HHHCCCCHHHHHHHH	40.71	29996109
24	Phosphorylation	AHFGAPSSVRRVLMS HHCCCCHHHHHHHHH	20.70	25720772
61	Phosphorylation	QITVIRGSNKGREGK CEEEEECCCCCCCCC	26.06	25720772
93	Phosphorylation	REKANGASAPVGIDA HHHHCCCCCCCCCCH	34.21	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RL26_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RL26_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RL26_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
YBD3_SCHPO	SPBC16C6.03c	genetic	22681890
PROB_SCHPO	SPAC17H9.13c	genetic	22681890
YNSI_SCHPO	SPBC18H10.18c	genetic	22681890
AATC_SCHPO	SPAC10F6.13c	genetic	22681890
CWC16_SCHPO	saf4	genetic	22681890
MMS19_SCHPO	mms19	genetic	22681890
RRP1_SCHPO	nop52	genetic	22681890

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.