UniProt ID | RL26_SCHPO | |
---|---|---|
UniProt AC | P78946 | |
Protein Name | 60S ribosomal protein L26 | |
Gene Name | rpl26 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 126 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MKFSRDVTSSRRKQRKAHFGAPSSVRRVLMSAPLSKELREQYKIRSLPVRRDDQITVIRGSNKGREGKITSVYRKKFLLLIERVTREKANGASAPVGIDASKVVITKLHLDKDRKDLIVRKGGKVE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
23 | Phosphorylation | KAHFGAPSSVRRVLM HHHCCCCHHHHHHHH | 40.71 | 29996109 | |
24 | Phosphorylation | AHFGAPSSVRRVLMS HHCCCCHHHHHHHHH | 20.70 | 25720772 | |
61 | Phosphorylation | QITVIRGSNKGREGK CEEEEECCCCCCCCC | 26.06 | 25720772 | |
93 | Phosphorylation | REKANGASAPVGIDA HHHHCCCCCCCCCCH | 34.21 | 28889911 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RL26_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RL26_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RL26_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
YBD3_SCHPO | SPBC16C6.03c | genetic | 22681890 | |
PROB_SCHPO | SPAC17H9.13c | genetic | 22681890 | |
YNSI_SCHPO | SPBC18H10.18c | genetic | 22681890 | |
AATC_SCHPO | SPAC10F6.13c | genetic | 22681890 | |
CWC16_SCHPO | saf4 | genetic | 22681890 | |
MMS19_SCHPO | mms19 | genetic | 22681890 | |
RRP1_SCHPO | nop52 | genetic | 22681890 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...