UniProt ID | CCS1_SCHPO | |
---|---|---|
UniProt AC | Q10357 | |
Protein Name | Superoxide dismutase 1 copper chaperone | |
Gene Name | ccs1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 297 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | Copper chaperone for superoxide dismutase 1 (sod1). Binds copper ions and delivers them specifically to sod1. Also has a role in cell protection against copper ion toxicity during conditions of copper excess. The C-terminal region is thought to act specifically in this sequestration role.. | |
Protein Sequence | MFEVEYLIKDCDDVNKNTLEQEFQDLNIEDWKWDAATGQLIVKGSVSPSKVLRRLENATSKPILIRGASNKESGVSILYEANEDITQIPKVYGLCRFIPTEEKIFLDLIATQLLPNREYTGLVTISGDISRGLKSAGDSLVTLFNANSNEQGKIVLDKEVSGSLPNWIGHCFVLKCVDDSDSATMGIISRSAGLGQNTKQICACTGKSLWTEHAELKSVNEGSSCCSKKDSSPSEKPSCCSQEKKSCCSSKKPSCCSQEKKGCCSTEKTSCCSQEKKSCCTSEKPSCCSNGKSTVCA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
231 | Phosphorylation | SCCSKKDSSPSEKPS CCCCCCCCCCCCCCC | 53.69 | 29996109 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CCS1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CCS1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CCS1_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CCS1_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...