dbPTM

YCK3_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YCK3_SCHPO
UniProt AC	Q9Y7N1
Protein Name	Uncharacterized protein C1450.03
Gene Name	SPCC1450.03
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	240
Subcellular Localization	Cytoplasm . Nucleus .
Protein Description
Protein Sequence	MAATTGNIIKFEENADSKDLLEQCLNCSDVGVVSNTVRNMDGTIAADLARTLIPAMLINMQPSLAIWLHWIIVTHGGYLTTVMDLQDSLVQLHEKLVQSAHLMTKIFSLSGKLNMVLSQEEMRQRRLDFSSEDGEEEEENDYIDEDVDEAGYDIEVVDEAENDDMDNDLEANADAFDESNLEASLSPNAELSPRKSHIDHDFVIPEDEMLSEEEEQEVEKQILPKFVVPESPRKTSRKSR

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
99	Phosphorylation	LHEKLVQSAHLMTKI HHHHHHHHHHHHHHH	15.35	29996109
108	Phosphorylation	HLMTKIFSLSGKLNM HHHHHHHHHHHHHHH	25.71	29996109
110	Phosphorylation	MTKIFSLSGKLNMVL HHHHHHHHHHHHHHC	32.46	29996109
196	Phosphorylation	AELSPRKSHIDHDFV CCCCCCHHHCCCCCC	27.27	21712547
211	Phosphorylation	IPEDEMLSEEEEQEV CCHHHCCCHHHHHHH	41.47	25720772
231	Phosphorylation	PKFVVPESPRKTSRK CCCCCCCCCCCCCCC	24.76	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YCK3_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YCK3_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YCK3_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of YCK3_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YCK3_SCHPO

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of fission yeast."; Wilson-Grady J.T., Villen J., Gygi S.P.; J. Proteome Res. 7:1088-1097(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-231, AND MASSSPECTROMETRY.	18257517 [Abstract]