dbPTM

YA78_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YA78_SCHPO
UniProt AC	Q09762
Protein Name	Uncharacterized protein C24H6.08
Gene Name	SPAC24H6.08
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	220
Subcellular Localization
Protein Description
Protein Sequence	MTSHQTGKIEVHWNDPSSGIFLSQTQRTSSTSSLKKSASSRRLVYGDDMLAPKPLAGQVLSKSPLPPFSPSKIMNRSISVPPTNISVPQISSNPLNLMKKSSDNDIFTTFNDTTNDCMNEASCEDVRHSLLQIIESKSNLSDSVHKMLGERVKTNLLLQGQLENMEGFWLQKLSQTCRLALTGNISEAKAFIVEIMCAGVVTNCVRWCPVLKTLIENLAI

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
23	Phosphorylation	PSSGIFLSQTQRTSS CCCCEEEEEECCCCC	22.04	21712547
25	Phosphorylation	SGIFLSQTQRTSSTS CCEEEEEECCCCCCC	19.35	21712547
28	Phosphorylation	FLSQTQRTSSTSSLK EEEEECCCCCCCHHH	19.74	24763107
29	Phosphorylation	LSQTQRTSSTSSLKK EEEECCCCCCCHHHH	33.53	24763107
30	Phosphorylation	SQTQRTSSTSSLKKS EEECCCCCCCHHHHH	31.53	21712547
37	Phosphorylation	STSSLKKSASSRRLV CCCHHHHHHCCCCEE	31.62	24763107
40	Phosphorylation	SLKKSASSRRLVYGD HHHHHHCCCCEEECC	22.57	21712547
69	Phosphorylation	KSPLPPFSPSKIMNR CCCCCCCCHHHHCCC	33.75	29996109
71	Phosphorylation	PLPPFSPSKIMNRSI CCCCCCHHHHCCCCC	33.35	29996109
101	Phosphorylation	PLNLMKKSSDNDIFT HHHHHHCCCCCCCCC	37.09	27738172

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YA78_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YA78_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YA78_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
YAWC_SCHPO	SPAC3F10.12c	physical	26771498
CDR2_SCHPO	cdr2	physical	26771498
ATG11_SCHPO	atg11	physical	26771498
NU211_SCHPO	nup211	physical	26771498

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YA78_SCHPO

Related Literatures of Post-Translational Modification