UniProt ID | RS26B_SCHPO | |
---|---|---|
UniProt AC | Q9UTG4 | |
Protein Name | 40S ribosomal protein S26-B | |
Gene Name | rps2602 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 119 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MTQKRRNNGRNKHGRGHVKFVRCINCSRAVPKDKAIKRWTIRNMVETAAIRDLSEASVYSEYTIPKLYIKLQYCVSCAIHSRVVRVRSREGRRIRTPPPRVRYNRDGKKVNPTAVAKNL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
54 | Phosphorylation | TAAIRDLSEASVYSE HHHHCCHHHCCCCCC | 35.09 | 25720772 | |
57 | Phosphorylation | IRDLSEASVYSEYTI HCCHHHCCCCCCCCC | 19.96 | 25720772 | |
62 | Phosphorylation | EASVYSEYTIPKLYI HCCCCCCCCCCHHHH | 12.20 | 25720772 | |
96 | Phosphorylation | REGRRIRTPPPRVRY CCCCCCCCCCCCCEE | 37.46 | 29996109 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RS26B_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RS26B_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RS26B_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
YGNB_SCHPO | nap2 | physical | 26771498 | |
TSR2_SCHPO | SPBC409.15 | physical | 26771498 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...