RS26B_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RS26B_SCHPO
• UniProt AC: Q9UTG4
• Protein Name: 40S ribosomal protein S26-B
• Gene Name: rps2602
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 119
• Protein Sequence: MTQKRRNNGRNKHGRGHVKFVRCINCSRAVPKDKAIKRWTIRNMVETAAIRDLSEASVYSEYTIPKLYIKLQYCVSCAIHSRVVRVRSREGRRIRTPPPRVRYNRDGKKVNPTAVAKNL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
54	Phosphorylation	TAAIRDLSEASVYSE HHHHCCHHHCCCCCC	35.09	25720772
57	Phosphorylation	IRDLSEASVYSEYTI HCCHHHCCCCCCCCC	19.96	25720772
62	Phosphorylation	EASVYSEYTIPKLYI HCCCCCCCCCCHHHH	12.20	25720772
96	Phosphorylation	REGRRIRTPPPRVRY CCCCCCCCCCCCCEE	37.46	29996109

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RS26B_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RS26B_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RS26B_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
YGNB_SCHPO	nap2	physical	26771498
TSR2_SCHPO	SPBC409.15	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.