TSR2_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TSR2_SCHPO
• UniProt AC: Q9UUA9
• Protein Name: Pre-rRNA-processing protein tsr2
• Gene Name: tsr2
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 179
• Subcellular Localization: Cytoplasm . Nucleus .
• Protein Description: Required for 20S pre-rRNA processing..
• Protein Sequence: MFDDPSKRLTYFEYAVGVLLCSWPVMKQAVEEEWADVDTADKRDWMAGVLVDYITVTSDVEAWDVEELILQVLQDEFNVGSIEDDSPYILAQDLVNVWKAACEDNYEPIREIHERLGKQLLEKEEGKEKTREESNPPVLVEDETIVDAEDGGAAQNQQEKQQGPIVDDDGFTVVQKRRR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
130	Phosphorylation	KEEGKEKTREESNPP HHHCHHCCCHHCCCC	44.39	29996109
134	Phosphorylation	KEKTREESNPPVLVE HHCCCHHCCCCEEEE	50.30	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TSR2_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TSR2_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TSR2_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
AFG2_SCHPO	SPBC56F2.07c	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.