COX18_SCHPO - dbPTM
COX18_SCHPO - PTM Information in dbPTM
Basic Information of Protein
UniProt ID COX18_SCHPO
UniProt AC O94587
Protein Name Cytochrome c oxidase assembly protein cox18, mitochondrial
Gene Name cox18
Organism Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length 202
Subcellular Localization Mitochondrion inner membrane
Multi-pass membrane protein.
Protein Description Required for the insertion of integral membrane proteins into the mitochondrial inner membrane. Essential for the activity and assembly of cytochrome c oxidase. Plays a central role in the translocation and export of the C-terminal part of the cox2 protein into the mitochondrial intermembrane space..
Protein Sequence MLQTLIGVHSYMPWCYEIPAMAIFLRSTITLPIAIASLKTARRFVQVQPLIKEAKKRCRTNTDFRTVRKKLYKRFNCHPLMIYALPITQLPLFAFASYQLRQAVDVCPESMSTEGMLWFTDLTLPDPHGVLPAVLAVTYLTNMSILKRPSDSRLLKIFNTAGIMSAFFVSFMAFKTSTALSLYWTTSAIYSLVQNVALRKLL
Overview of Protein Modification Sites with Functional and Structural Information
Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations Modification Substrate Peptides
&
Secondary Structure
ASA (%) Reference Orthologous
Protein Cluster

Oops, there are no PTM records of COX18_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)
Modified Location Modified Residue Modification Type of Upstream Proteins Gene Name of Upstream Proteins UniProt AC of Upstream Proteins Sources

Oops, there are no upstream regulatory protein records of COX18_SCHPO !!

Functions of PTM Sites
Modified Location Modified Residue Modification Function Reference

Oops, there are no descriptions of PTM sites of COX18_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location Modification Variant Position
(Distance <= 10)
Residue Change SAP Related Disease Reference

Oops, there are no SNP-PTM records of COX18_SCHPO !!

Protein-Protein Interaction
Interacting Protein Gene Name Interaction Type PPI Reference Domain-Domain Interactions

Oops, there are no PPI records of COX18_SCHPO !!

Drug and Disease Associations
Kegg Drug
DrugBank
There are no disease associations of PTM sites.
Regulatory Network of COX18_SCHPO

loading...

Related Literatures of Post-Translational Modification

TOP