dbPTM

FNTB_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	FNTB_SCHPO
UniProt AC	O13782
Protein Name	Protein farnesyltransferase subunit beta
Gene Name	cpp1
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	382
Subcellular Localization
Protein Description	Catalyzes the transfer of a farnesyl moiety from farnesyl diphosphate to a cysteine at the fourth position from the C-terminus of several proteins. The beta subunit is responsible for peptide-binding..
Protein Sequence	MDELSETQVMQNETATAVLPLLNGESQSFNLQKHLKYLTKMLDPLPSPFTVLDASRAWMVYWELSSLAILGKLDSSVCERAISSVRQLKGPSGGFCGGNGQDEHLLSTYASILSICLCDSTDAYSLIERDRLYDWLFSLKNPDGSFRVNNEGESDARSVYAAVCVSSLVGISMDDPLFEGTLQWLCKCQTYEGGLSGVPYAEAHGGYTFCALAAIALLGGLDNLNEIKLSTWLVQRQDPALYGFSGRSNKLVDGCYSWWVGASHVIVASGYGSASHKSLPNLFYNPEKLLGYILQCCQSTSGGLRDKPPKRPDQYHTCYCLLGLSSIAYDYRYHTSDGWSYKPSILHSSLSSLLPAHPIYCVPFGFEERIKSYFLSQESSKF

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of FNTB_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of FNTB_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of FNTB_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of FNTB_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
FNTA_SCHPO	cwp1	genetic	16624901
GGPPS_SCHPO	spo9	genetic	16624901
ZFS1_SCHPO	zfs1	genetic	16624901
YKT6_SCHPO	ykt6	genetic	16624901
STE11_SCHPO	ste11	genetic	16624901
RAS_SCHPO	ras1	genetic	10617635
FNTA_SCHPO	cwp1	physical	10617635
HMDH_SCHPO	hmg1	genetic	20847589
RHB1_SCHPO	rhb1	genetic	10617635
RHO2_SCHPO	rho2	genetic	17005909
FNTA_SCHPO	cwp1	physical	26771498

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of FNTB_SCHPO

Related Literatures of Post-Translational Modification