RHB1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RHB1_SCHPO
• UniProt AC: O94363
• Protein Name: GTP-binding protein rhb1
• Gene Name: rhb1
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 185
• Subcellular Localization: Cell membrane ; Lipid-anchor ; Cytoplasmic side .
• Protein Description: Regulates entry into stationary phase when extracellular nitrogen levels are adequate for growth..
• Protein Sequence: MAPIKSRRIAVLGSRSVGKSSLTVQYVENHFVESYYPTIENTFSKNIKYKGQEFATEIIDTAGQDEYSILNSKHSIGIHGYVLVYSITSKSSFEMVKIVRDKILNHTGTEWVPIVVVGNKSDLHMQRAVTAEEGKALANEWKCAWTEASARHNENVARAFELIISEIEKQANPSPPGDGKGCVIA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
182	Methylation	PPGDGKGCVIA---- CCCCCCCCCCC----	1.97	-
182	Farnesylation	PPGDGKGCVIA---- CCCCCCCCCCC----	1.97	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RHB1_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RHB1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RHB1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TOR2_SCHPO	tor2	genetic	17360675
YE08_SCHPO	SPAC17H9.08	genetic	22681890
TSPO_SCHPO	SPBC725.10	genetic	22681890
HMT2_SCHPO	hmt2	genetic	22681890
YFM8_SCHPO	SPAC222.08c	genetic	22681890
AROG_SCHPO	SPAP8A3.07c	genetic	22681890
YPT71_SCHPO	ypt71	genetic	22681890
RS10A_SCHPO	rps1001	genetic	22681890

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.