YKT6_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YKT6_SCHPO
• UniProt AC: O60073
• Protein Name: Synaptobrevin homolog ykt6
• Gene Name: ykt6
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 197
• Subcellular Localization: Cell membrane ; Lipid-anchor ; Cytoplasmic side .
• Protein Sequence: MKLYSVSILRFDPKPVQLLCTASDLSSFSFFQRSSIGEFMNFFTKTVAERTNPGQRQDVEQSNYVFHVYNRSDGLCGVIASDKEYPLRVAYTLLNKILDEFLTKNPRTKWESGAVTLSFPELDTYLSKYQDPKQADTIMRVQQELDETKDVLHKTIESVLARGEKLDDLIQRSDNLSTQSRMFYKSAKKQNSCCIIA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
158	Phosphorylation	VLHKTIESVLARGEK HHHHHHHHHHHCCCC	20.69	24763107
173	Phosphorylation	LDDLIQRSDNLSTQS HHHHHHHCCCCCHHH	17.93	21712547
177	Phosphorylation	IQRSDNLSTQSRMFY HHHCCCCCHHHHHHH	30.56	21712547
178	Phosphorylation	QRSDNLSTQSRMFYK HHCCCCCHHHHHHHH	33.46	21712547
180	Phosphorylation	SDNLSTQSRMFYKSA CCCCCHHHHHHHHHH	26.29	24763107
184	Phosphorylation	STQSRMFYKSAKKQN CHHHHHHHHHHHHCC	8.49	24763107
193	S-palmitoylation	SAKKQNSCCIIA--- HHHHCCCCEEEC---	2.24	-
194	Methylation	AKKQNSCCIIA---- HHHCCCCEEEC----	2.24	-
194	Farnesylation	AKKQNSCCIIA---- HHHCCCCEEEC----	2.24	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YKT6_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YKT6_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YKT6_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of YKT6_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.