UniProt ID | YKT6_SCHPO | |
---|---|---|
UniProt AC | O60073 | |
Protein Name | Synaptobrevin homolog ykt6 | |
Gene Name | ykt6 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 197 | |
Subcellular Localization |
Cell membrane Lipid-anchor Cytoplasmic side . |
|
Protein Description | ||
Protein Sequence | MKLYSVSILRFDPKPVQLLCTASDLSSFSFFQRSSIGEFMNFFTKTVAERTNPGQRQDVEQSNYVFHVYNRSDGLCGVIASDKEYPLRVAYTLLNKILDEFLTKNPRTKWESGAVTLSFPELDTYLSKYQDPKQADTIMRVQQELDETKDVLHKTIESVLARGEKLDDLIQRSDNLSTQSRMFYKSAKKQNSCCIIA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
158 | Phosphorylation | VLHKTIESVLARGEK HHHHHHHHHHHCCCC | 20.69 | 24763107 | |
173 | Phosphorylation | LDDLIQRSDNLSTQS HHHHHHHCCCCCHHH | 17.93 | 21712547 | |
177 | Phosphorylation | IQRSDNLSTQSRMFY HHHCCCCCHHHHHHH | 30.56 | 21712547 | |
178 | Phosphorylation | QRSDNLSTQSRMFYK HHCCCCCHHHHHHHH | 33.46 | 21712547 | |
180 | Phosphorylation | SDNLSTQSRMFYKSA CCCCCHHHHHHHHHH | 26.29 | 24763107 | |
184 | Phosphorylation | STQSRMFYKSAKKQN CHHHHHHHHHHHHCC | 8.49 | 24763107 | |
193 | S-palmitoylation | SAKKQNSCCIIA--- HHHHCCCCEEEC--- | 2.24 | - | |
194 | Methylation | AKKQNSCCIIA---- HHHCCCCEEEC---- | 2.24 | - | |
194 | Farnesylation | AKKQNSCCIIA---- HHHCCCCEEEC---- | 2.24 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YKT6_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YKT6_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YKT6_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of YKT6_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...