| UniProt ID | MED27_SCHPO | |
|---|---|---|
| UniProt AC | Q10477 | |
| Protein Name | Mediator of RNA polymerase II transcription subunit 27 | |
| Gene Name | med27 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 273 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.. | |
| Protein Sequence | MSLEEQRTRDELKHKLLDLNQLHEQLAELRTICPSLLKLLHPETGTSRKFEKSAQEAIEKVNSFYTHLKSSQNVFDYAEKSLQADSSNLLPTYLYNSEDLSNDTENNETKSINGKSALDLKEPHHSELHDNDNFQNSDINIESFKGDIEASGSILTTHENKSFTLKLANELEFIFFHDTRGKFSVYCSSSKDDAITFSINRNNNFLGNLWSLMPKILDYQHLYSKPCDFCKSLISPVYLELPSVRRNANSTVKPTSKDILALHAECVPAQSDL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 111 | Phosphorylation | TENNETKSINGKSAL CCCCCEECCCCCCCC | 28.80 | 27738172 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MED27_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MED27_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MED27_SCHPO !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| MED17_SCHPO | srb4 | physical | 11572939 | |
| RPB1_SCHPO | rpb1 | physical | 11572939 | |
| MED18_SCHPO | med18 | physical | 11572939 | |
| ELP3_SCHPO | elp3 | genetic | 18818364 | |
| PPK16_SCHPO | ppk16 | genetic | 18818364 | |
| PEF1_SCHPO | pef1 | genetic | 18818364 | |
| AAKB_SCHPO | amk2 | genetic | 18818364 | |
| CCR4_SCHPO | ccr4 | genetic | 18818364 | |
| DAD2_SCHPO | dad2 | genetic | 18818364 | |
| MCL1_SCHPO | mcl1 | genetic | 18818364 | |
| SRB11_SCHPO | srb11 | genetic | 18818364 | |
| ELOC_SCHPO | SPBC1861.07 | genetic | 18818364 | |
| ASK1_SCHPO | ask1 | genetic | 18818364 | |
| NGG1_SCHPO | ngg1 | genetic | 18818364 | |
| VPS71_SCHPO | vps71 | genetic | 18818364 | |
| HRR1_SCHPO | hrr1 | genetic | 18818364 | |
| DCR1_SCHPO | dcr1 | genetic | 18818364 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
