dbPTM

YBE8_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YBE8_SCHPO
UniProt AC	O74763
Protein Name	Uncharacterized WD repeat-containing protein C17D11.08
Gene Name	SPBC17D11.08
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	435
Subcellular Localization	Cytoplasm . Golgi apparatus .
Protein Description
Protein Sequence	MTDLRRNRYSISAGVGKSVLDSLGKFYGSPKRQLPNKFEAGKEYTGYNAPWIPFALDWLKQGKYSSEWIAMGSLNEEPNNMIQLLKLITGDDGNSHLEKAQAATDLEYPVTKLLWNPSSVGSNTDSQLLASTDQQLRLWKTDFEAGIDSPLLCQASLSTHVKTHNNAPLTSFDWCKTDPSYIVVSSLDTTCTVWDIVAQQSKTQLIAHDKEVYDVAFLKDSINVFVSVGADGSVRMFDLRSLDHSTIIYEGDSTFWKRNGDYTNASPPVSAPLLRLSACDSDVNLMATFHHNSSDVQMIDIRVPGTAYATLRGHKGDVNAVKWMPGSKSKLATCGDDCVVSLWDLDQPVNPSPAPTLSVSGTTPGMTGSTSEYVTPVSSVNSMRETASPLNADNQYSPLLSWKLEHEVNNLSWSVKNDGLAVVYGKSLEILKVPQ

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
9	Phosphorylation	TDLRRNRYSISAGVG CCHHHCCCEECCCCC	17.57	25720772
10	Phosphorylation	DLRRNRYSISAGVGK CHHHCCCEECCCCCH	13.56	29996109
12	Phosphorylation	RRNRYSISAGVGKSV HHCCCEECCCCCHHH	17.03	25720772
29	Phosphorylation	SLGKFYGSPKRQLPN HHHHHHCCCCCCCCC	18.83	28889911
266	Phosphorylation	NGDYTNASPPVSAPL CCCCCCCCCCCCCCE	31.63	28889911
270	Phosphorylation	TNASPPVSAPLLRLS CCCCCCCCCCEEEHH	29.91	19547744
386	Phosphorylation	SVNSMRETASPLNAD HCCCHHCCCCCCCCC	23.28	29996109
388	Phosphorylation	NSMRETASPLNADNQ CCHHCCCCCCCCCCC	37.02	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YBE8_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YBE8_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YBE8_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of YBE8_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YBE8_SCHPO

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of fission yeast."; Wilson-Grady J.T., Villen J., Gygi S.P.; J. Proteome Res. 7:1088-1097(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-266 AND SER-388, ANDMASS SPECTROMETRY.	18257517 [Abstract]