UniProt ID | PSD1_SCHPO | |
---|---|---|
UniProt AC | O14333 | |
Protein Name | Phosphatidylserine decarboxylase proenzyme 1, mitochondrial {ECO:0000255|HAMAP-Rule:MF_03208, ECO:0000303|PubMed:19286980} | |
Gene Name | psd1 {ECO:0000255|HAMAP-Rule:MF_03208, ECO:0000303|PubMed:19286980} | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 437 | |
Subcellular Localization |
Phosphatidylserine decarboxylase 1 beta chain: Mitochondrion . Mitochondrion inner membrane Single-pass membrane protein Intermembrane side . Phosphatidylserine decarboxylase 1 alpha chain: Mitochondrion . Mitochondrion inner membrane Peripheral me |
|
Protein Description | Catalyzes the formation of phosphatidylethanolamine (PtdEtn) from phosphatidylserine (PtdSer). Plays a central role in phospholipid metabolism and in the interorganelle trafficking of phosphatidylserine (By similarity). Together with psd2 and psd3, responsible for the majority of phosphatidylethanolamine synthesis. [PubMed: 19286980] | |
Protein Sequence | MLKFHRNVKPQFGAFARYSSLGKHNSRKRVGIIRLAYGLTGIGLVGLAGFAWAQDRHEKTYQKKGVQVEGPWQFYVLTTLPLRTLSRWWGYVNRIEIPLWMRVPAFGLYSKIFGCNLTEADPDDVRQYKNLAEFFTRKLKPGARVIDPDAPIVIPADGKILNYGVIEGGQLEQVKGITYSLDALLGDEKLARLKRSHAIPSPDHIPHIRQEEFAKLNGIHYSLQDLMGHDHGERPSHVKDASAQHIDLLSSTKVAAKSQFTLFGSRETNCLYYAVIYLAPGDYHRFHSPTDWVVERRRHFSGELFSVSPFMARRLGNLFILNERVALMGRYKYGFMSMIPVGATNVGSIRIKFDKDLCTNQFGKLGPVGTFDEAVYTSSSSILHGHPLLRGDEVGNFELGSTVVLVFEAPADFEFLVKQGQKVRVGLPLGRVVPSSH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PSD1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PSD1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PSD1_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of PSD1_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...