UniProt ID | YHX7_YEAST | |
---|---|---|
UniProt AC | P38867 | |
Protein Name | Uncharacterized protein YHR177W | |
Gene Name | YHR177W | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 453 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MMDISPTCYGYIDDEQDLALVFQGVFNGNLRCIERRPYDAEKVELVNPGNIFVFNEEKSGIKRWTDGFSWSPSRISGKFLVYREYNRLGSTHDLPLHNVPEYNIFERAHRKYFYTGLLKKTFSLKFNMDPTDSTKLETFHLIAYYTEKDIHQGSLRRPSENPFFHKFRPSQKLLDALQKVAVGNGRSNPSKNNERGRTKAHNYKTRRSLSSSPSYCDLLSNYNNHPGNIPVRTAVQLPLTTFNNAPREMHQQQHRQQQQYLLPIDEQNKLPLPYMQHQPQPIGVYNPNYQPGLRRTVSQPMIFCNTYNTLPQQPTAAPYERRGVSPSVIYSSNTLSPIPYQNIDPYSSRSGPECNHSKAPIAPTMMPPVHHILVHDYRQPKPVTDSINPPNVNITTSTTNKNLDGIYILPAPRMNPPAQTQYQMIHAPDSMQHPPTFSKNNTSSNPKSHQYSK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
90 | Phosphorylation | REYNRLGSTHDLPLH EEECCCCCCCCCCCC | 27.45 | 22369663 | |
91 | Phosphorylation | EYNRLGSTHDLPLHN EECCCCCCCCCCCCC | 20.01 | 22369663 | |
102 | Phosphorylation | PLHNVPEYNIFERAH CCCCCCCCCHHHHHH | 13.90 | 22369663 | |
208 | Phosphorylation | HNYKTRRSLSSSPSY HHHHHHHCCCCCHHH | 29.34 | 22369663 | |
210 | Phosphorylation | YKTRRSLSSSPSYCD HHHHHCCCCCHHHHH | 29.98 | 22369663 | |
211 | Phosphorylation | KTRRSLSSSPSYCDL HHHHCCCCCHHHHHH | 52.11 | 21440633 | |
212 | Phosphorylation | TRRSLSSSPSYCDLL HHHCCCCCHHHHHHH | 17.94 | 22369663 | |
214 | Phosphorylation | RSLSSSPSYCDLLSN HCCCCCHHHHHHHHH | 40.10 | 21440633 | |
215 | Phosphorylation | SLSSSPSYCDLLSNY CCCCCHHHHHHHHHC | 8.05 | 21440633 | |
220 | Phosphorylation | PSYCDLLSNYNNHPG HHHHHHHHHCCCCCC | 44.56 | 19779198 | |
296 | Phosphorylation | YQPGLRRTVSQPMIF CCCCCCCCCCCCEEE | 20.34 | 19779198 | |
298 | Phosphorylation | PGLRRTVSQPMIFCN CCCCCCCCCCEEEEC | 28.14 | 28889911 | |
325 | Phosphorylation | PYERRGVSPSVIYSS CCHHCCCCHHHEEEC | 17.80 | 22369663 | |
327 | Phosphorylation | ERRGVSPSVIYSSNT HHCCCCHHHEEECCC | 17.40 | 22369663 | |
330 | Phosphorylation | GVSPSVIYSSNTLSP CCCHHHEEECCCCCC | 12.14 | 22369663 | |
331 | Phosphorylation | VSPSVIYSSNTLSPI CCHHHEEECCCCCCC | 13.14 | 22369663 | |
332 | Phosphorylation | SPSVIYSSNTLSPIP CHHHEEECCCCCCCC | 19.50 | 22369663 | |
334 | Phosphorylation | SVIYSSNTLSPIPYQ HHEEECCCCCCCCCC | 30.47 | 22369663 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YHX7_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YHX7_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YHX7_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-298, AND MASSSPECTROMETRY. |