| UniProt ID | YHX7_YEAST | |
|---|---|---|
| UniProt AC | P38867 | |
| Protein Name | Uncharacterized protein YHR177W | |
| Gene Name | YHR177W | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 453 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MMDISPTCYGYIDDEQDLALVFQGVFNGNLRCIERRPYDAEKVELVNPGNIFVFNEEKSGIKRWTDGFSWSPSRISGKFLVYREYNRLGSTHDLPLHNVPEYNIFERAHRKYFYTGLLKKTFSLKFNMDPTDSTKLETFHLIAYYTEKDIHQGSLRRPSENPFFHKFRPSQKLLDALQKVAVGNGRSNPSKNNERGRTKAHNYKTRRSLSSSPSYCDLLSNYNNHPGNIPVRTAVQLPLTTFNNAPREMHQQQHRQQQQYLLPIDEQNKLPLPYMQHQPQPIGVYNPNYQPGLRRTVSQPMIFCNTYNTLPQQPTAAPYERRGVSPSVIYSSNTLSPIPYQNIDPYSSRSGPECNHSKAPIAPTMMPPVHHILVHDYRQPKPVTDSINPPNVNITTSTTNKNLDGIYILPAPRMNPPAQTQYQMIHAPDSMQHPPTFSKNNTSSNPKSHQYSK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 90 | Phosphorylation | REYNRLGSTHDLPLH EEECCCCCCCCCCCC | 27.45 | 22369663 | |
| 91 | Phosphorylation | EYNRLGSTHDLPLHN EECCCCCCCCCCCCC | 20.01 | 22369663 | |
| 102 | Phosphorylation | PLHNVPEYNIFERAH CCCCCCCCCHHHHHH | 13.90 | 22369663 | |
| 208 | Phosphorylation | HNYKTRRSLSSSPSY HHHHHHHCCCCCHHH | 29.34 | 22369663 | |
| 210 | Phosphorylation | YKTRRSLSSSPSYCD HHHHHCCCCCHHHHH | 29.98 | 22369663 | |
| 211 | Phosphorylation | KTRRSLSSSPSYCDL HHHHCCCCCHHHHHH | 52.11 | 21440633 | |
| 212 | Phosphorylation | TRRSLSSSPSYCDLL HHHCCCCCHHHHHHH | 17.94 | 22369663 | |
| 214 | Phosphorylation | RSLSSSPSYCDLLSN HCCCCCHHHHHHHHH | 40.10 | 21440633 | |
| 215 | Phosphorylation | SLSSSPSYCDLLSNY CCCCCHHHHHHHHHC | 8.05 | 21440633 | |
| 220 | Phosphorylation | PSYCDLLSNYNNHPG HHHHHHHHHCCCCCC | 44.56 | 19779198 | |
| 296 | Phosphorylation | YQPGLRRTVSQPMIF CCCCCCCCCCCCEEE | 20.34 | 19779198 | |
| 298 | Phosphorylation | PGLRRTVSQPMIFCN CCCCCCCCCCEEEEC | 28.14 | 28889911 | |
| 325 | Phosphorylation | PYERRGVSPSVIYSS CCHHCCCCHHHEEEC | 17.80 | 22369663 | |
| 327 | Phosphorylation | ERRGVSPSVIYSSNT HHCCCCHHHEEECCC | 17.40 | 22369663 | |
| 330 | Phosphorylation | GVSPSVIYSSNTLSP CCCHHHEEECCCCCC | 12.14 | 22369663 | |
| 331 | Phosphorylation | VSPSVIYSSNTLSPI CCHHHEEECCCCCCC | 13.14 | 22369663 | |
| 332 | Phosphorylation | SPSVIYSSNTLSPIP CHHHEEECCCCCCCC | 19.50 | 22369663 | |
| 334 | Phosphorylation | SVIYSSNTLSPIPYQ HHEEECCCCCCCCCC | 30.47 | 22369663 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YHX7_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YHX7_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YHX7_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-298, AND MASSSPECTROMETRY. | |
