UniProt ID | YGP9_YEAST | |
---|---|---|
UniProt AC | P53110 | |
Protein Name | Uncharacterized protein YGL159W | |
Gene Name | YGL159W | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 370 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MNNSIITDDEVREFYLNCSSQTIIESLLSLHESLRLYSQNHEILLNRMFKKLDETNADSNISHIFMPVVSKDFSGIKILVNNNNKNFQGVINVIEPETGKLIGCFEAKQITAIRTALASCIGLYKQLSCSHDKLFRFENGTCYLTCFGTGLQAFWHIYIAIKLIMSGIVGESLKLVEINILYHNNMMSLDRLKSLKNLFGSNIKIELNQYQINDISSEGNGAVSNSDIIFGCLPTLEPNLFLRQLLNSKASVEQKHTYISLIGSYKPVMHECDKELIDKFKSDNESACILVDSREHTLLESGELIDSNIAPHNLIEIGELDTLKNTVLNLNEKGCKRTITLCKIVGLAVMDVALAKEFLSLRTKNTENKE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MNNSIITD -------CCCCCCCC | 10.92 | 22814378 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YGP9_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YGP9_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YGP9_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
STE50_YEAST | STE50 | genetic | 27708008 | |
RIM1_YEAST | RIM1 | genetic | 27708008 | |
RLA1_YEAST | RPP1A | genetic | 27708008 | |
RV167_YEAST | RVS167 | genetic | 27708008 | |
ATG1_YEAST | ATG1 | genetic | 27708008 | |
RTF1_YEAST | RTF1 | genetic | 27708008 | |
LDB18_YEAST | LDB18 | genetic | 27708008 | |
JNM1_YEAST | JNM1 | genetic | 27708008 | |
MAS5_YEAST | YDJ1 | genetic | 27708008 | |
ADH1_YEAST | ADH1 | genetic | 27708008 | |
TBP6_YEAST | YTA6 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...