| UniProt ID | TRM61_YEAST | |
|---|---|---|
| UniProt AC | P46959 | |
| Protein Name | tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRM61 | |
| Gene Name | GCD14 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 383 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Catalytic subunit of tRNA (adenine-N(1)-)-methyltransferase, which catalyzes the formation of N(1)-methyladenine at position 58 (m1A58) in initiator methionyl-tRNA. [PubMed: 10779558] | |
| Protein Sequence | MSTNCFSGYKDLIKEGDLTLIWVSRDNIKPVRMHSEEVFNTRYGSFPHKDIIGKPYGSQIAIRTKGSNKFAFVHVLQPTPELWTLSLPHRTQIVYTPDSSYIMQRLNCSPHSRVIEAGTGSGSFSHAFARSVGHLFSFEFHHIRYEQALEEFKEHGLIDDNVTITHRDVCQGGFLIKKGDTTSYEFGNNETAASLNANVVFLDLPAPWDAIPHLDSVISVDEKVGLCCFSPCIEQVDKTLDVLEKYGWTDVEMVEIQGRQYESRRQMVRSLNDALERLRDIKRHKLQGVERRKRMFNNTIDSNDEKVGKRNEDGVPLTEKAKFNPFGKGSRIKEGDSNYKWKEVTKMEAEIKSHTSYLTFAFKVVNRSRDDEKVNEILRSTEK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 91 | Phosphorylation | TLSLPHRTQIVYTPD EEECCCCEEEEECCC | 21.44 | 19779198 | |
| 95 | Phosphorylation | PHRTQIVYTPDSSYI CCCEEEEECCCHHHH | 17.74 | 19779198 | |
| 96 | Phosphorylation | HRTQIVYTPDSSYIM CCEEEEECCCHHHHH | 15.10 | 19779198 | |
| 99 | Phosphorylation | QIVYTPDSSYIMQRL EEEECCCHHHHHHHH | 26.67 | 28889911 | |
| 100 | Phosphorylation | IVYTPDSSYIMQRLN EEECCCHHHHHHHHC | 26.51 | 19779198 | |
| 101 | Phosphorylation | VYTPDSSYIMQRLNC EECCCHHHHHHHHCC | 12.36 | 19779198 | |
| 302 | Phosphorylation | MFNNTIDSNDEKVGK HHHCCCCCCCCCCCC | 42.18 | 21551504 | |
| 306 | Acetylation | TIDSNDEKVGKRNED CCCCCCCCCCCCCCC | 60.18 | 24489116 | |
| 339 | Phosphorylation | IKEGDSNYKWKEVTK CCCCCCCCCCEEHHH | 23.37 | 27017623 | |
| 380 | Phosphorylation | KVNEILRSTEK---- HHHHHHHHCCC---- | 37.16 | 30377154 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TRM61_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TRM61_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TRM61_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-302, AND MASSSPECTROMETRY. | |
