| UniProt ID | NANOG_HUMAN | |
|---|---|---|
| UniProt AC | Q9H9S0 | |
| Protein Name | Homeobox protein NANOG | |
| Gene Name | NANOG | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 305 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Transcription regulator involved in inner cell mass and embryonic stem (ES) cells proliferation and self-renewal. Imposes pluripotency on ES cells and prevents their differentiation towards extraembryonic endoderm and trophectoderm lineages. Blocks bone morphogenetic protein-induced mesoderm differentiation of ES cells by physically interacting with SMAD1 and interfering with the recruitment of coactivators to the active SMAD transcriptional complexes. Acts as a transcriptional activator or repressor. Binds optimally to the DNA consensus sequence 5'-TAAT[GT][GT]-3' or 5'-[CG][GA][CG]C[GC]ATTAN[GC]-3'. Binds to the POU5F1/OCT4 promoter. [PubMed: 25825768 Able to autorepress its expression in differentiating (ES) cells: binds to its own promoter following interaction with ZNF281/ZFP281, leading to recruitment of the NuRD complex and subsequent repression of expression. When overexpressed, promotes cells to enter into S phase and proliferation.] | |
| Protein Sequence | MSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSAEKSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPMWSNQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQSWNNQAWNSPFYNCGEESLQSCMQFQPNSPASDLEAALEAAGEGLNVIQQTTRYFSTPQTMDLFLNYSMNMQPEDV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 35 | Phosphorylation | ICGPEENYPSLQMSS EECCHHCCCCCCCCC | 9.47 | 22493428 | |
| 50 | Phosphorylation | AEMPHTETVSPLPSS CCCCCCCCCCCCCCH | 27.69 | - | |
| 52 | Phosphorylation | MPHTETVSPLPSSMD CCCCCCCCCCCCHHC | 28.30 | - | |
| 56 | Phosphorylation | ETVSPLPSSMDLLIQ CCCCCCCCHHCEEEE | 46.08 | - | |
| 57 | Phosphorylation | TVSPLPSSMDLLIQD CCCCCCCHHCEEEEC | 17.86 | - | |
| 65 | Phosphorylation | MDLLIQDSPDSSTSP HCEEEECCCCCCCCC | 17.77 | - | |
| 68 | Phosphorylation | LIQDSPDSSTSPKGK EEECCCCCCCCCCCC | 38.61 | - | |
| 69 | Phosphorylation | IQDSPDSSTSPKGKQ EECCCCCCCCCCCCC | 40.04 | 26546556 | |
| 70 | Phosphorylation | QDSPDSSTSPKGKQP ECCCCCCCCCCCCCC | 53.66 | - | |
| 71 | Phosphorylation | DSPDSSTSPKGKQPT CCCCCCCCCCCCCCC | 26.94 | 26546556 | |
| 78 | Phosphorylation | SPKGKQPTSAEKSVA CCCCCCCCCHHHHHC | 37.77 | - | |
| 79 | Phosphorylation | PKGKQPTSAEKSVAK CCCCCCCCHHHHHCC | 40.91 | - | |
| 119 | Phosphorylation | DRFQRQKYLSLQQMQ HHHHHHHHCCHHHHH | 7.99 | 27067055 | |
| 121 | Phosphorylation | FQRQKYLSLQQMQEL HHHHHHCCHHHHHHH | 22.50 | 27067055 | |
| 129 | Phosphorylation | LQQMQELSNILNLSY HHHHHHHHHHHCCCH | 22.52 | 27067055 | |
| 135 | Phosphorylation | LSNILNLSYKQVKTW HHHHHCCCHHHHHHH | 29.25 | 27067055 | |
| 174 | Phosphorylation | QKASAPTYPSLYSSY CCCCCCCCHHHHHHC | 6.97 | 22493428 | |
| 200 | Phosphorylation | LPMWSNQTWNNSTWS CCCCCCCCCCCCCCC | 34.12 | - | |
| 258 | Phosphorylation | CMQFQPNSPASDLEA HHCCCCCCCHHHHHH | 28.64 | - | |
| 280 | Phosphorylation | GLNVIQQTTRYFSTP HHHHHHHHCCCCCCC | 9.25 | - | |
| 286 | Phosphorylation | QTTRYFSTPQTMDLF HHCCCCCCCHHHHHH | 14.98 | - | |
| 289 | Phosphorylation | RYFSTPQTMDLFLNY CCCCCCHHHHHHHHH | 17.54 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
| 35 | Y | Phosphorylation | Kinase | PTK2 | Q05397 | GPS |
| 52 | S | Phosphorylation | Kinase | ERK2 | P28482 | PSP |
| 65 | S | Phosphorylation | Kinase | CDK1 | P06493 | PSP |
| 65 | S | Phosphorylation | Kinase | ERK2 | P28482 | PSP |
| 68 | S | Phosphorylation | Kinase | BRAF | P15056 | PSP |
| 71 | S | Phosphorylation | Kinase | CDK1 | P06493 | PSP |
| 78 | T | Phosphorylation | Kinase | PRKCE | Q02156 | GPS |
| 79 | S | Phosphorylation | Kinase | PRKCE | Q02156 | GPS |
| 135 | S | Phosphorylation | Kinase | PRKCE | Q02156 | GPS |
| 174 | Y | Phosphorylation | Kinase | PTK2 | Q05397 | GPS |
| 200 | T | Phosphorylation | Kinase | PRKCE | Q02156 | GPS |
| 280 | T | Phosphorylation | Kinase | PRKCE | Q02156 | GPS |
| - | K | Ubiquitination | E3 ubiquitin ligase | SPOP | O43791 | PMID:31624231:30595538 |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NANOG_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NANOG_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...