UniProt ID | CFA20_HUMAN | |
---|---|---|
UniProt AC | Q9Y6A4 | |
Protein Name | Cilia- and flagella-associated protein 20 | |
Gene Name | CFAP20 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 193 | |
Subcellular Localization | Nucleus. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriole. Cytoplasm, cytoskeleton, cilium basal body. Cell projection, cilium. | |
Protein Description | Cilium- and flagellum-specific protein that plays a role in axonemal structure organization and motility. Involved in the regulation of the size and morphology of cilia. [PubMed: 24414207 Required for axonemal microtubules polyglutamylation] | |
Protein Sequence | MFKNTFQSGFLSILYSIGSKPLQIWDKKVRNGHIKRITDNDIQSLVLEIEGTNVSTTYITCPADPKKTLGIKLPFLVMIIKNLKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDDGWNQIQFNLLDFTRRAYGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFKLYLPVQNKAKQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
19 | Phosphorylation | SILYSIGSKPLQIWD HHHHHCCCCCCEEEC | 24719451 | ||
27 | Ubiquitination | KPLQIWDKKVRNGHI CCCEEECHHCCCCCE | 29967540 | ||
27 | Acetylation | KPLQIWDKKVRNGHI CCCEEECHHCCCCCE | 23236377 | ||
86 | Phosphorylation | IIKNLKKYFTFEVQV HHHCHHHEEEEEEEE | 22817900 | ||
110 | Phosphorylation | FRASNYQSTTRVKPF HHHCCCCCCCCEECE | 30622161 | ||
111 | Phosphorylation | RASNYQSTTRVKPFI HHCCCCCCCCEECEE | 30622161 | ||
112 | Phosphorylation | ASNYQSTTRVKPFIC HCCCCCCCCEECEEE | 30622161 | ||
115 | Ubiquitination | YQSTTRVKPFICTMP CCCCCCEECEEEECC | 23000965 | ||
115 | Acetylation | YQSTTRVKPFICTMP CCCCCCEECEEEECC | 26051181 | ||
120 | Phosphorylation | RVKPFICTMPMRLDD CEECEEEECCEEECC | - | ||
170 | Methylation | RRVYFSDRLYSEDEL EEEEECCCCCCCCCC | - | ||
173 | Phosphorylation | YFSDRLYSEDELPAE EECCCCCCCCCCCCE | - | ||
182 | Ubiquitination | DELPAEFKLYLPVQN CCCCCEEEEEEECCC | 22817900 | ||
184 | Phosphorylation | LPAEFKLYLPVQNKA CCCEEEEEEECCCCC | 28796482 | ||
184 | Nitration | LPAEFKLYLPVQNKA CCCEEEEEEECCCCC | - | ||
190 | Acetylation | LYLPVQNKAKQ---- EEEECCCCCCC---- | 25953088 | ||
190 | Ubiquitination | LYLPVQNKAKQ---- EEEECCCCCCC---- | 32015554 | ||
192 | Ubiquitination | LPVQNKAKQ------ EECCCCCCC------ | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CFA20_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CFA20_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CFA20_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...