UniProt ID | TF2L1_HUMAN | |
---|---|---|
UniProt AC | Q9NZI6 | |
Protein Name | Transcription factor CP2-like protein 1 | |
Gene Name | TFCP2L1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 479 | |
Subcellular Localization | Nucleus . | |
Protein Description | Transcription factor that facilitates establishment and maintenance of pluripotency in embryonic stem cells (ESCs). [PubMed: 25215486] | |
Protein Sequence | MLFWHTQPEHYNQHNSGSYLRDVLALPIFKQEEPQLSPENEARLPPLQYVLCAATSPAVKLHEETLTYLNQGQSYEIRLLENRKLGDFQDLNTKYVKSIIRVVFHDRRLQYTEHQQLEGWRWSRPGDRILDIDIPLSVGILDPRASPTQLNAVEFLWDPAKRASAFIQVHCISTEFTPRKHGGEKGVPFRVQIDTFKQNENGEYTEHLHSASCQIKVFKPKGADRKQKTDREKMEKRTAQEKEKYQPSYETTILTECSPWPDVAYQVNSAPSPSYNGSPNSFGLGEGNASPTHPVEALPVGSDHLLPSASIQDAQQWLHRNRFSQFCRLFASFSGADLLKMSRDDLVQICGPADGIRLFNAIKGRNVRPKMTIYVCQELEQNRVPLQQKRDGSGDSNLSVYHAIFLEELTTLELIEKIANLYSISPQHIHRVYRQGPTGIHVVVSNEMVQNFQDESCFVLSTIKAESNDGYHIILKCGL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
30 | Sumoylation | VLALPIFKQEEPQLS HHHHEECCCCCCCCC | 58.48 | - | |
30 | Sumoylation | VLALPIFKQEEPQLS HHHHEECCCCCCCCC | 58.48 | - | |
30 | Ubiquitination | VLALPIFKQEEPQLS HHHHEECCCCCCCCC | 58.48 | - | |
37 | Phosphorylation | KQEEPQLSPENEARL CCCCCCCCCCCCCCC | 25.56 | 28355574 | |
111 | Phosphorylation | FHDRRLQYTEHQQLE HCCCCCCCEECHHCC | 20.77 | 20068231 | |
112 | Phosphorylation | HDRRLQYTEHQQLEG CCCCCCCEECHHCCC | 17.65 | 20068231 | |
137 | Phosphorylation | LDIDIPLSVGILDPR EEEECCEEEEECCCC | 16.97 | 24719451 | |
146 | Phosphorylation | GILDPRASPTQLNAV EECCCCCCHHHCCHH | 29.74 | 28348404 | |
148 | Phosphorylation | LDPRASPTQLNAVEF CCCCCCHHHCCHHHH | 43.10 | 24719451 | |
173 | Phosphorylation | FIQVHCISTEFTPRK EEEEEEEECCCCCCC | 27.55 | 24719451 | |
174 | Phosphorylation | IQVHCISTEFTPRKH EEEEEEECCCCCCCC | 18.40 | 28348404 | |
177 | Phosphorylation | HCISTEFTPRKHGGE EEEECCCCCCCCCCC | 18.89 | 21857030 | |
185 | Ubiquitination | PRKHGGEKGVPFRVQ CCCCCCCCCCCEEEE | 69.36 | - | |
195 | Phosphorylation | PFRVQIDTFKQNENG CEEEEEECEEECCCC | 34.07 | - | |
221 | Ubiquitination | QIKVFKPKGADRKQK EEEEECCCCCCCCCC | 68.28 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
177 | T | Phosphorylation | Kinase | CDK1 | P06493 | PSP |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TF2L1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TF2L1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of TF2L1_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...