CDK20_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CDK20_HUMAN
• UniProt AC: Q8IZL9
• Protein Name: Cyclin-dependent kinase 20
• Gene Name: CDK20
• Organism: Homo sapiens (Human).
• Sequence Length: 346
• Subcellular Localization: Nucleus . Cytoplasm. Cell projection, cilium.
• Protein Description: Required for high-level Shh responses in the developing neural tube. Together with TBC1D32, controls the structure of the primary cilium by coordinating assembly of the ciliary membrane and axoneme, allowing GLI2 to be properly activated in response to SHH signaling (By similarity). Involved in cell growth. Activates CDK2, a kinase involved in the control of the cell cycle, by phosphorylating residue 'Thr-160'..
• Protein Sequence: MDQYCILGRIGEGAHGIVFKAKHVETGEIVALKKVALRRLEDGFPNQALREIKALQEMEDNQYVVQLKAVFPHGGGFVLAFEFMLSDLAEVVRHAQRPLAQAQVKSYLQMLLKGVAFCHANNIVHRDLKPANLLISASGQLKIADFGLARVFSPDGSRLYTHQVATRWYRAPELLYGARQYDQGVDLWSVGCIMGELLNGSPLFPGKNDIEQLCYVLRILGTPNPQVWPELTELPDYNKISFKEQVPMPLEEVLPDVSPQALDLLGQFLLYPPHQRIAASKALLHQYFFTAPLPAHPSELPIPQRLGGPAPKAHPGPPHIHDFHVDRPLEESLLNPELIRPFILEG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
4	Phosphorylation	----MDQYCILGRIG ----CCCEEEEEECC	4.17	29759185
20	Ubiquitination	GAHGIVFKAKHVETG CCCEEEEEEEECCCC	45.70	-
22	Ubiquitination	HGIVFKAKHVETGEI CEEEEEEEECCCCCE	49.09	-
33	Ubiquitination	TGEIVALKKVALRRL CCCEEEEEEHHHHHC	35.15	2190698
33 (in isoform 3)	Ubiquitination	-	35.15	21906983
33 (in isoform 2)	Ubiquitination	-	35.15	21906983
33 (in isoform 1)	Ubiquitination	-	35.15	21906983
34	Ubiquitination	GEIVALKKVALRRLE CCEEEEEEHHHHHCC	33.32	-
53 (in isoform 3)	Ubiquitination	-	37.99	21906983
53	Ubiquitination	NQALREIKALQEMED HHHHHHHHHHHHCCC	37.99	21906983
53 (in isoform 1)	Ubiquitination	-	37.99	21906983
53 (in isoform 2)	Ubiquitination	-	37.99	21906983
106	Phosphorylation	LAQAQVKSYLQMLLK HHHHHHHHHHHHHHH	32.02	20860994
129 (in isoform 3)	Ubiquitination	-	46.50	21906983
129 (in isoform 2)	Ubiquitination	-	46.50	21906983
129 (in isoform 1)	Ubiquitination	-	46.50	21906983
129	Ubiquitination	NIVHRDLKPANLLIS CEECCCCCHHHEEEE	46.50	21906983
160	Phosphorylation	SPDGSRLYTHQVATR CCCCCCCEEECCCCC	10.89	28152594
161	Phosphorylation	PDGSRLYTHQVATRW CCCCCCEEECCCCCC	15.49	28152594
218 (in isoform 3)	Ubiquitination	-	16.43	21906983
239 (in isoform 1)	Ubiquitination	-	33.23	21906983
239	Ubiquitination	TELPDYNKISFKEQV HCCCCCCCCCCCCCC	33.23	21906983
241	Phosphorylation	LPDYNKISFKEQVPM CCCCCCCCCCCCCCC	31.69	24719451
281	Ubiquitination	HQRIAASKALLHQYF HHHHHHHHHHHHHHH	38.02	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CDK20_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CDK20_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CDK20_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ICK_HUMAN	ICK	physical	16954377
PPP5_HUMAN	PPP5C	physical	16954377
CDK2_HUMAN	CDK2	physical	14597612
CSK2B_HUMAN	CSNK2B	physical	18508765
CCNH_HUMAN	CCNH	physical	18508765
GTD2A_HUMAN	GTF2IRD2	physical	18508765
PANK4_HUMAN	PANK4	physical	18508765
CDK12_HUMAN	CDK12	physical	23602568
RB6I2_HUMAN	ERC1	physical	23602568
FKBP8_HUMAN	FKBP8	physical	23602568
TRAD1_HUMAN	TRAFD1	physical	23602568
EF2_HUMAN	EEF2	physical	23602568
FACD2_HUMAN	FANCD2	physical	23602568
SMC1A_HUMAN	SMC1A	physical	23602568
RBBP4_HUMAN	RBBP4	physical	23602568
PRS10_HUMAN	PSMC6	physical	23602568
PSMD1_HUMAN	PSMD1	physical	23602568
PSB2_HUMAN	PSMB2	physical	23602568
MAGD2_HUMAN	MAGED2	physical	23602568
CHIP_HUMAN	STUB1	physical	23602568
PSB5_HUMAN	PSMB5	physical	23602568
RPB2_HUMAN	POLR2B	physical	23602568
NTPCR_HUMAN	NTPCR	physical	23602568
OZF_HUMAN	ZNF146	physical	23602568
RAF1_HUMAN	RAF1	physical	23602568
AT1A1_HUMAN	ATP1A1	physical	23602568
NOP58_HUMAN	NOP58	physical	23602568
HDAC1_HUMAN	HDAC1	physical	27173435
XYLT2_HUMAN	XYLT2	physical	27173435
KEAP1_HUMAN	KEAP1	physical	28534518
AHSA1_HUMAN	AHSA1	physical	28534518
PSA_HUMAN	NPEPPS	physical	28534518
FKBP8_HUMAN	FKBP8	physical	28534518
BORG5_HUMAN	CDC42EP1	physical	28534518
NDUS3_HUMAN	NDUFS3	physical	28534518
MIRO1_HUMAN	RHOT1	physical	28534518
LBR_HUMAN	LBR	physical	28534518

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.