| UniProt ID | ICK_HUMAN | |
|---|---|---|
| UniProt AC | Q9UPZ9 | |
| Protein Name | Serine/threonine-protein kinase ICK | |
| Gene Name | ICK | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 632 | |
| Subcellular Localization | Nucleus . Cytoplasm, cytosol . Cell projection, cilium . Cytoplasm, cytoskeleton, cilium basal body . Also found at the ciliary tip (PubMed:24797473). Nuclear localization has been observed with a GFP-tagged construct in transfected HeLa cells (PubMe | |
| Protein Description | Required for ciliogenesis. [PubMed: 24797473 Phosphorylates KIF3A (By similarity Involved in the control of ciliary length] | |
| Protein Sequence | MNRYTTIRQLGDGTYGSVLLGRSIESGELIAIKKMKRKFYSWEECMNLREVKSLKKLNHANVVKLKEVIRENDHLYFIFEYMKENLYQLIKERNKLFPESAIRNIMYQILQGLAFIHKHGFFHRDLKPENLLCMGPELVKIADFGLAREIRSKPPYTDYVSTRWYRAPEVLLRSTNYSSPIDVWAVGCIMAEVYTLRPLFPGASEIDTIFKICQVLGTPKKTDWPEGYQLSSAMNFRWPQCVPNNLKTLIPNASSEAVQLLRDMLQWDPKKRPTASQALRYPYFQVGHPLGSTTQNLQDSEKPQKGILEKAGPPPYIKPVPPAQPPAKPHTRISSRQHQASQPPLHLTYPYKAEVSRTDHPSHLQEDKPSPLLFPSLHNKHPQSKITAGLEHKNGEIKPKSRRRWGLISRSTKDSDDWADLDDLDFSPSLSRIDLKNKKRQSDDTLCRFESVLDLKPSEPVGTGNSAPTQTSYQRRDTPTLRSAAKQHYLKHSRYLPGISIRNGILSNPGKEFIPPNPWSSSGLSGKSSGTMSVISKVNSVGSSSTSSSGLTGNYVPSFLKKEIGSAMQRVHLAPIPDPSPGYSSLKAMRPHPGRPFFHTQPRSTPGLIPRPPAAQPVHGRTDWASKYASRR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of ICK_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ICK_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ICK_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ICK_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| RPTOR_HUMAN | RPTOR | physical | 22356909 | |
| MK01_HUMAN | MAPK1 | physical | 16954377 | |
| CDC7_HUMAN | CDC7 | physical | 16954377 | |
| MAT1_HUMAN | MNAT1 | physical | 16954377 | |
| BAG6_HUMAN | BAG6 | physical | 16954377 | |
| A4_HUMAN | APP | physical | 21832049 | |
| MK01_HUMAN | MAPK1 | physical | 8626561 | |
| CD3Z_HUMAN | CD247 | physical | 8626561 | |
| HS90A_HUMAN | HSP90AA1 | physical | 22939624 | |
| CPSF1_HUMAN | CPSF1 | physical | 23602568 | |
| PSMD1_HUMAN | PSMD1 | physical | 23602568 | |
| NU188_HUMAN | NUP188 | physical | 23602568 | |
| P53_HUMAN | TP53 | physical | 23602568 | |
| PRS10_HUMAN | PSMC6 | physical | 23602568 | |
| SMYD2_HUMAN | SMYD2 | physical | 27173435 | |
| IF172_HUMAN | IFT172 | physical | 27173435 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| 612651 | Endocrine-cerebroosteodysplasia (ECO) | |||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
