| UniProt ID | RABEK_HUMAN | |
|---|---|---|
| UniProt AC | Q7Z6M1 | |
| Protein Name | Rab9 effector protein with kelch motifs | |
| Gene Name | RABEPK | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 372 | |
| Subcellular Localization | Cytoplasm. Endosome membrane. Interaction with PIP5K3 and subsequent phosphorylation recruits it to the endosomal membrane. | |
| Protein Description | Rab9 effector required for endosome to trans-Golgi network (TGN) transport.. | |
| Protein Sequence | MKQLPVLEPGDKPRKATWYTLTVPGDSPCARVGHSCSYLPPVGNAKRGKVFIVGGANPNRSFSDVHTMDLGKHQWDLDTCKGLLPRYEHASFIPSCTPDRIWVFGGANQSGNRNCLQVLNPETRTWTTPEVTSPPPSPRTFHTSSAAIGNQLYVFGGGERGAQPVQDTKLHVFDANTLTWSQPETLGNPPSPRHGHVMVAAGTKLFIHGGLAGDRFYDDLHCIDISDMKWQKLNPTGAAPAGCAAHSAVAMGKHVYIFGGMTPAGALDTMYQYHTEEQHWTLLKFDTLLPPGRLDHSMCIIPWPVTCASEKEDSNSLTLNHEAEKEDSADKVMSHSGDSHEESQTATLLCLVFGGMNTEGEIYDDCIVTVVD | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 12 | Acetylation | PVLEPGDKPRKATWY CCCCCCCCCCCEEEE | 53.27 | 25953088 | |
| 12 | Ubiquitination | PVLEPGDKPRKATWY CCCCCCCCCCCEEEE | 53.27 | - | |
| 15 | Ubiquitination | EPGDKPRKATWYTLT CCCCCCCCEEEEEEE | 59.71 | - | |
| 17 | Phosphorylation | GDKPRKATWYTLTVP CCCCCCEEEEEEECC | 23.26 | - | |
| 19 | Phosphorylation | KPRKATWYTLTVPGD CCCCEEEEEEECCCC | 6.37 | - | |
| 22 | Phosphorylation | KATWYTLTVPGDSPC CEEEEEEECCCCCCC | 19.49 | 25627689 | |
| 27 | Phosphorylation | TLTVPGDSPCARVGH EEECCCCCCCCCCCC | 28.00 | 25627689 | |
| 46 | Ubiquitination | LPPVGNAKRGKVFIV CCCCCCCCCCCEEEE | 66.73 | - | |
| 49 (in isoform 2) | Ubiquitination | - | 37.70 | 21906983 | |
| 49 (in isoform 1) | Ubiquitination | - | 37.70 | 21906983 | |
| 49 | Ubiquitination | VGNAKRGKVFIVGGA CCCCCCCCEEEECCC | 37.70 | 21906983 | |
| 61 | Phosphorylation | GGANPNRSFSDVHTM CCCCCCCCCCCCCEE | 35.42 | 25159151 | |
| 63 | Phosphorylation | ANPNRSFSDVHTMDL CCCCCCCCCCCEECC | 39.71 | 25159151 | |
| 72 | Ubiquitination | VHTMDLGKHQWDLDT CCEECCCCCEECHHH | 39.66 | - | |
| 81 | Ubiquitination | QWDLDTCKGLLPRYE EECHHHCCCCCCCCC | 55.47 | - | |
| 110 | Phosphorylation | VFGGANQSGNRNCLQ EECCCCCCCCCCCEE | 37.53 | - | |
| 118 (in isoform 2) | Ubiquitination | - | 3.44 | 21906983 | |
| 125 | Phosphorylation | VLNPETRTWTTPEVT EECCCCCCEECCCCC | 34.28 | 20873877 | |
| 127 | Phosphorylation | NPETRTWTTPEVTSP CCCCCCEECCCCCCC | 31.68 | 20873877 | |
| 128 | Phosphorylation | PETRTWTTPEVTSPP CCCCCEECCCCCCCC | 14.71 | 20873877 | |
| 132 | Phosphorylation | TWTTPEVTSPPPSPR CEECCCCCCCCCCCC | 33.58 | 25850435 | |
| 133 | Phosphorylation | WTTPEVTSPPPSPRT EECCCCCCCCCCCCC | 40.35 | 25690035 | |
| 137 | Phosphorylation | EVTSPPPSPRTFHTS CCCCCCCCCCCEECC | 32.56 | 20873877 | |
| 160 | Methylation | YVFGGGERGAQPVQD EEECCCCCCCCCCCC | 49.36 | 115489999 | |
| 169 | Ubiquitination | AQPVQDTKLHVFDAN CCCCCCCEEEEEECC | 44.90 | 2190698 | |
| 169 (in isoform 1) | Ubiquitination | - | 44.90 | 21906983 | |
| 185 | Phosphorylation | LTWSQPETLGNPPSP CEECCCCCCCCCCCC | 46.80 | 28450419 | |
| 191 | Phosphorylation | ETLGNPPSPRHGHVM CCCCCCCCCCCCCEE | 35.50 | 28450419 | |
| 229 | Ubiquitination | CIDISDMKWQKLNPT EEECHHCCEEECCCC | 52.00 | - | |
| 232 | Ubiquitination | ISDMKWQKLNPTGAA CHHCCEEECCCCCCC | 49.47 | - | |
| 314 | Phosphorylation | CASEKEDSNSLTLNH CCCCCCCCCCCCCCC | 29.43 | 25159151 | |
| 316 | Phosphorylation | SEKEDSNSLTLNHEA CCCCCCCCCCCCCHH | 27.04 | 25849741 | |
| 318 | Phosphorylation | KEDSNSLTLNHEAEK CCCCCCCCCCCHHHC | 25.90 | 23927012 | |
| 325 | Ubiquitination | TLNHEAEKEDSADKV CCCCHHHCCCCCCHH | 74.08 | - | |
| 328 | Phosphorylation | HEAEKEDSADKVMSH CHHHCCCCCCHHHHC | 39.19 | 28985074 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RABEK_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RABEK_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RABEK_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| ZYX_HUMAN | ZYX | physical | 21900206 | |
| PRKRA_HUMAN | PRKRA | physical | 21900206 | |
| NCPR_HUMAN | POR | physical | 21900206 | |
| TMM98_HUMAN | TMEM98 | physical | 21900206 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
