UniProt ID | OTX2_HUMAN | |
---|---|---|
UniProt AC | P32243 | |
Protein Name | Homeobox protein OTX2 | |
Gene Name | OTX2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 289 | |
Subcellular Localization | Nucleus . | |
Protein Description | Transcription factor probably involved in the development of the brain and the sense organs. Can bind to the bicoid/BCD target sequence (BTS): 5'-TCTAATCCC-3'.. | |
Protein Sequence | MMSYLKQPPYAVNGLSLTTSGMDLLHPSVGYPATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKTSPAREVSSESGTSGQFTPPSSTSVPTIASSSAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYTQASGYSQGYAGSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGTNAVTSHLNQSPASLSTQGYGASSLGFNSTTDCLDYKDQTASWKLNFNADCLDYKDQTSSWKFQVL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Phosphorylation | -----MMSYLKQPPY -----CCCCCCCCCC | 26.47 | 24043423 | |
4 | Phosphorylation | ----MMSYLKQPPYA ----CCCCCCCCCCE | 10.46 | 24043423 | |
10 | Phosphorylation | SYLKQPPYAVNGLSL CCCCCCCCEECCEEE | 29.84 | 24043423 | |
16 | Phosphorylation | PYAVNGLSLTTSGMD CCEECCEEEECCCCC | 25.68 | 24043423 | |
18 | Phosphorylation | AVNGLSLTTSGMDLL EECCEEEECCCCCCC | 18.62 | 24043423 | |
19 | Phosphorylation | VNGLSLTTSGMDLLH ECCEEEECCCCCCCC | 28.69 | 24043423 | |
19 (in isoform 2) | Phosphorylation | - | 28.69 | 22210691 | |
20 | Phosphorylation | NGLSLTTSGMDLLHP CCEEEECCCCCCCCC | 27.21 | 24043423 | |
20 (in isoform 2) | Phosphorylation | - | 27.21 | 22210691 | |
28 | Phosphorylation | GMDLLHPSVGYPATP CCCCCCCCCCCCCCC | 19.89 | 24043423 | |
31 | Phosphorylation | LLHPSVGYPATPRKQ CCCCCCCCCCCCCHH | 6.37 | 24043423 | |
31 (in isoform 2) | Phosphorylation | - | 6.37 | 22210691 | |
34 | Phosphorylation | PSVGYPATPRKQRRE CCCCCCCCCCHHHHH | 21.08 | 24043423 | |
37 (in isoform 2) | Phosphorylation | - | 49.73 | 22210691 | |
42 (in isoform 2) | Phosphorylation | - | 36.94 | 22210691 | |
265 | Phosphorylation | DYKDQTASWKLNFNA CCCCCCCEEEEEECC | 28.29 | 24719451 | |
283 | Phosphorylation | DYKDQTSSWKFQVL- CCCCCCCCCEEEEC- | 37.36 | 22210691 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of OTX2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of OTX2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of OTX2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
FOXA2_HUMAN | FOXA2 | physical | 12642491 | |
OTX2_HUMAN | OTX2 | physical | 10623575 | |
FOXA2_HUMAN | FOXA2 | physical | 10623575 | |
LHX1_HUMAN | LHX1 | physical | 10623575 | |
A4_HUMAN | APP | physical | 21832049 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...