| UniProt ID | OTX2_HUMAN | |
|---|---|---|
| UniProt AC | P32243 | |
| Protein Name | Homeobox protein OTX2 | |
| Gene Name | OTX2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 289 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Transcription factor probably involved in the development of the brain and the sense organs. Can bind to the bicoid/BCD target sequence (BTS): 5'-TCTAATCCC-3'.. | |
| Protein Sequence | MMSYLKQPPYAVNGLSLTTSGMDLLHPSVGYPATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKTSPAREVSSESGTSGQFTPPSSTSVPTIASSSAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYTQASGYSQGYAGSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGTNAVTSHLNQSPASLSTQGYGASSLGFNSTTDCLDYKDQTASWKLNFNADCLDYKDQTSSWKFQVL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 3 | Phosphorylation | -----MMSYLKQPPY -----CCCCCCCCCC | 26.47 | 24043423 | |
| 4 | Phosphorylation | ----MMSYLKQPPYA ----CCCCCCCCCCE | 10.46 | 24043423 | |
| 10 | Phosphorylation | SYLKQPPYAVNGLSL CCCCCCCCEECCEEE | 29.84 | 24043423 | |
| 16 | Phosphorylation | PYAVNGLSLTTSGMD CCEECCEEEECCCCC | 25.68 | 24043423 | |
| 18 | Phosphorylation | AVNGLSLTTSGMDLL EECCEEEECCCCCCC | 18.62 | 24043423 | |
| 19 | Phosphorylation | VNGLSLTTSGMDLLH ECCEEEECCCCCCCC | 28.69 | 24043423 | |
| 19 (in isoform 2) | Phosphorylation | - | 28.69 | 22210691 | |
| 20 | Phosphorylation | NGLSLTTSGMDLLHP CCEEEECCCCCCCCC | 27.21 | 24043423 | |
| 20 (in isoform 2) | Phosphorylation | - | 27.21 | 22210691 | |
| 28 | Phosphorylation | GMDLLHPSVGYPATP CCCCCCCCCCCCCCC | 19.89 | 24043423 | |
| 31 | Phosphorylation | LLHPSVGYPATPRKQ CCCCCCCCCCCCCHH | 6.37 | 24043423 | |
| 31 (in isoform 2) | Phosphorylation | - | 6.37 | 22210691 | |
| 34 | Phosphorylation | PSVGYPATPRKQRRE CCCCCCCCCCHHHHH | 21.08 | 24043423 | |
| 37 (in isoform 2) | Phosphorylation | - | 49.73 | 22210691 | |
| 42 (in isoform 2) | Phosphorylation | - | 36.94 | 22210691 | |
| 265 | Phosphorylation | DYKDQTASWKLNFNA CCCCCCCEEEEEECC | 28.29 | 24719451 | |
| 283 | Phosphorylation | DYKDQTSSWKFQVL- CCCCCCCCCEEEEC- | 37.36 | 22210691 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of OTX2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of OTX2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of OTX2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| FOXA2_HUMAN | FOXA2 | physical | 12642491 | |
| OTX2_HUMAN | OTX2 | physical | 10623575 | |
| FOXA2_HUMAN | FOXA2 | physical | 10623575 | |
| LHX1_HUMAN | LHX1 | physical | 10623575 | |
| A4_HUMAN | APP | physical | 21832049 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
