| UniProt ID | LHX1_HUMAN | |
|---|---|---|
| UniProt AC | P48742 | |
| Protein Name | LIM/homeobox protein Lhx1 | |
| Gene Name | LHX1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 406 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Potential transcription factor. May play a role in early mesoderm formation and later in lateral mesoderm differentiation and neurogenesis.. | |
| Protein Sequence | MVHCAGCKRPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGKLYCKNDFFRCFGTKCAGCAQGISPSDLVRRARSKVFHLNCFTCMMCNKQLSTGEELYIIDENKFVCKEDYLSNSSVAKENSLHSATTGSDPSLSPDSQDPSQDDAKDSESANVSDKEAGSNENDDQNLGAKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALGARRHAFFRSPRRMRPLVDRLEPGELIPNGPFSFYGDYQSEYYGPGGNYDFFPQGPPSSQAQTPVDLPFVPSSGPSGTPLGGLEHPLPGHHPSSEAQRFTDILAHPPGDSPSPEPSLPGPLHSMSAEVFGPSPPFSSLSVNGGASYGNHLSHPPEMNEAAVW | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 48 | Sumoylation | KCFSREGKLYCKNDF HHHCCCCEEEECCCH | 31.37 | - | |
| 48 | Sumoylation | KCFSREGKLYCKNDF HHHCCCCEEEECCCH | 31.37 | - | |
| 71 | Phosphorylation | AGCAQGISPSDLVRR CCCCCCCCHHHHHHH | 25.77 | - | |
| 142 | Phosphorylation | TGSDPSLSPDSQDPS CCCCCCCCCCCCCCC | 30.88 | 25849741 | |
| 156 | Phosphorylation | SQDDAKDSESANVSD CCCCCCCHHHCCCCH | 32.51 | 26126808 | |
| 158 | Phosphorylation | DDAKDSESANVSDKE CCCCCHHHCCCCHHH | 29.15 | 26126808 | |
| 162 | Phosphorylation | DSESANVSDKEAGSN CHHHCCCCHHHCCCC | 42.65 | 20363803 | |
| 168 | Phosphorylation | VSDKEAGSNENDDQN CCHHHCCCCCCCCCC | 48.28 | 26126808 | |
| 206 | Phosphorylation | FAATPKPTRHIREQL HHCCCCCCHHHHHHH | 40.79 | 26434552 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LHX1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LHX1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LHX1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| FOXA2_HUMAN | FOXA2 | physical | 12642491 | |
| LHX3_HUMAN | LHX3 | physical | 9452425 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
