| UniProt ID | LHX3_HUMAN | |
|---|---|---|
| UniProt AC | Q9UBR4 | |
| Protein Name | LIM/homeobox protein Lhx3 | |
| Gene Name | LHX3 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 397 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Acts as a transcriptional activator. Binds to and activates the promoter of the alpha-glycoprotein gene, and synergistically enhances transcription from the prolactin promoter in cooperation with POU1F1/Pit-1 (By similarity). Required for the establishment of the specialized cells of the pituitary gland and the nervous system. Involved in the development of interneurons and motor neurons in cooperation with LDB1 and ISL1.. | |
| Protein Sequence | MLLETGLERDRARPGAAAVCTLGGTREIPLCAGCDQHILDRFILKALDRHWHSKCLKCSDCHTPLAERCFSRGESVYCKDDFFKRFGTKCAACQLGIPPTQVVRRAQDFVYHLHCFACVVCKRQLATGDEFYLMEDSRLVCKADYETAKQREAEATAKRPRTTITAKQLETLKSAYNTSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGRQRWGQYFRNMKRSRGGSKSDKDSVQEGQDSDAEVSFPDEPSLAEMGPANGLYGSLGEPTQALGRPSGALGNFSLEHGGLAGPEQYRELRPGSPYGVPPSPAAPQSLPGPQPLLSSLVYPDTSLGLVPSGAPGGPPPMRVLAGNGPSSDLSTGSSGGYPDFPASPASWLDEVDHAQF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 63 | Phosphorylation | LKCSDCHTPLAERCF CCCCCCCCHHHHHHH | 26.74 | 15517599 | |
| 71 | Phosphorylation | PLAERCFSRGESVYC HHHHHHHHCCCCEEE | 42.89 | 15517599 | |
| 156 | Phosphorylation | KQREAEATAKRPRTT HHHHHHHHCCCCCCE | 24.98 | 26546556 | |
| 159 | Methylation | EAEATAKRPRTTITA HHHHHCCCCCCEEEH | 24.38 | - | |
| 161 | Methylation | EATAKRPRTTITAKQ HHHCCCCCCEEEHHH | 48.84 | - | |
| 174 | Phosphorylation | KQLETLKSAYNTSPK HHHHHHHHHHCCCCC | 38.81 | 23663014 | |
| 176 | Phosphorylation | LETLKSAYNTSPKPA HHHHHHHHCCCCCHH | 26.51 | 23663014 | |
| 178 | Phosphorylation | TLKSAYNTSPKPARH HHHHHHCCCCCHHHH | 33.46 | 23663014 | |
| 179 | Phosphorylation | LKSAYNTSPKPARHV HHHHHCCCCCHHHHH | 27.56 | 23663014 | |
| 227 | Phosphorylation | GRQRWGQYFRNMKRS HHHHHHHHHHHHHHH | 10.68 | 15517599 | |
| 234 | Phosphorylation | YFRNMKRSRGGSKSD HHHHHHHHCCCCCCC | 29.74 | 15517599 | |
| 238 | Phosphorylation | MKRSRGGSKSDKDSV HHHHCCCCCCCHHHH | 31.63 | 10835633 |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LHX3_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LHX3_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CITE2_HUMAN | CITED2 | physical | 10593900 | |
| IF172_HUMAN | IFT172 | physical | 10788441 | |
| RNF12_HUMAN | RLIM | physical | 10431247 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...