LHX3_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: LHX3_HUMAN
• UniProt AC: Q9UBR4
• Protein Name: LIM/homeobox protein Lhx3
• Gene Name: LHX3
• Organism: Homo sapiens (Human).
• Sequence Length: 397
• Subcellular Localization: Nucleus .
• Protein Description: Acts as a transcriptional activator. Binds to and activates the promoter of the alpha-glycoprotein gene, and synergistically enhances transcription from the prolactin promoter in cooperation with POU1F1/Pit-1 (By similarity). Required for the establishment of the specialized cells of the pituitary gland and the nervous system. Involved in the development of interneurons and motor neurons in cooperation with LDB1 and ISL1..
• Protein Sequence: MLLETGLERDRARPGAAAVCTLGGTREIPLCAGCDQHILDRFILKALDRHWHSKCLKCSDCHTPLAERCFSRGESVYCKDDFFKRFGTKCAACQLGIPPTQVVRRAQDFVYHLHCFACVVCKRQLATGDEFYLMEDSRLVCKADYETAKQREAEATAKRPRTTITAKQLETLKSAYNTSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGRQRWGQYFRNMKRSRGGSKSDKDSVQEGQDSDAEVSFPDEPSLAEMGPANGLYGSLGEPTQALGRPSGALGNFSLEHGGLAGPEQYRELRPGSPYGVPPSPAAPQSLPGPQPLLSSLVYPDTSLGLVPSGAPGGPPPMRVLAGNGPSSDLSTGSSGGYPDFPASPASWLDEVDHAQF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
63	Phosphorylation	LKCSDCHTPLAERCF CCCCCCCCHHHHHHH	26.74	15517599
71	Phosphorylation	PLAERCFSRGESVYC HHHHHHHHCCCCEEE	42.89	15517599
156	Phosphorylation	KQREAEATAKRPRTT HHHHHHHHCCCCCCE	24.98	26546556
159	Methylation	EAEATAKRPRTTITA HHHHHCCCCCCEEEH	24.38	-
161	Methylation	EATAKRPRTTITAKQ HHHCCCCCCEEEHHH	48.84	-
174	Phosphorylation	KQLETLKSAYNTSPK HHHHHHHHHHCCCCC	38.81	23663014
176	Phosphorylation	LETLKSAYNTSPKPA HHHHHHHHCCCCCHH	26.51	23663014
178	Phosphorylation	TLKSAYNTSPKPARH HHHHHHCCCCCHHHH	33.46	23663014
179	Phosphorylation	LKSAYNTSPKPARHV HHHHHCCCCCHHHHH	27.56	23663014
227	Phosphorylation	GRQRWGQYFRNMKRS HHHHHHHHHHHHHHH	10.68	15517599
234	Phosphorylation	YFRNMKRSRGGSKSD HHHHHHHHCCCCCCC	29.74	15517599
238	Phosphorylation	MKRSRGGSKSDKDSV HHHHCCCCCCCHHHH	31.63	10835633

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
-	K	Ubiquitination	E3 ubiquitin ligase	RLIM	Q9NVW2	PMID:31801865

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of LHX3_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of LHX3_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CITE2_HUMAN	CITED2	physical	10593900
IF172_HUMAN	IFT172	physical	10788441
RNF12_HUMAN	RLIM	physical	10431247

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.