| UniProt ID | PCGF1_HUMAN | |
|---|---|---|
| UniProt AC | Q9BSM1 | |
| Protein Name | Polycomb group RING finger protein 1 | |
| Gene Name | PCGF1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 259 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Component of the Polycomb group (PcG) multiprotein BCOR complex, a complex required to maintain the transcriptionally repressive state of some genes, such as BCL6 and the cyclin-dependent kinase inhibitor, CDKN1A. Transcriptional repressor that may be targeted to the DNA by BCL6; this transcription repressor activity may be related to PKC signaling pathway. Represses CDKN1A expression by binding to its promoter, and this repression is dependent on the retinoic acid response element (RARE element). Promotes cell cycle progression and enhances cell proliferation as well. May have a positive role in tumor cell growth by down-regulating CDKN1A. Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. [PubMed: 26151332 Within the PRC1-like complex, regulates RNF2 ubiquitin ligase activity] | |
| Protein Sequence | MASPQGGQIAIAMRLRNQLQSVYKMDPLRNEEEVRVKIKDLNEHIVCCLCAGYFVDATTITECLHTFCKSCIVKYLQTSKYCPMCNIKIHETQPLLNLKLDRVMQDIVYKLVPGLQDSEEKRIREFYQSRGLDRVTQPTGEEPALSNLGLPFSSFDHSKAHYYRYDEQLNLCLERLSSGKDKNKSVLQNKYVRCSVRAEVRHLRRVLCHRLMLNPQHVQLLFDNEVLPDHMTMKQIWLSRWFGKPSPLLLQYSVKEKRR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MASPQGGQI ------CCCCCHHHH | 29.89 | 20068231 | |
| 3 | Phosphorylation | -----MASPQGGQIA -----CCCCCHHHHH | 19.23 | 23401153 | |
| 21 | Phosphorylation | RLRNQLQSVYKMDPL HHHHHHHHHHCCCCC | 35.69 | 28555341 | |
| 24 | Sumoylation | NQLQSVYKMDPLRNE HHHHHHHCCCCCCCH | 34.37 | 28112733 | |
| 69 | Ubiquitination | ECLHTFCKSCIVKYL HHHHHHHHHHHHHHH | 44.14 | 22817900 | |
| 70 | Phosphorylation | CLHTFCKSCIVKYLQ HHHHHHHHHHHHHHH | 15.40 | 24719451 | |
| 74 (in isoform 1) | Ubiquitination | - | 21.97 | 21890473 | |
| 74 | Ubiquitination | FCKSCIVKYLQTSKY HHHHHHHHHHHHCCC | 21.97 | 21890473 | |
| 76 (in isoform 3) | Ubiquitination | - | 3.57 | 21890473 | |
| 87 (in isoform 3) | Ubiquitination | - | 3.64 | 21890473 | |
| 88 | Sumoylation | YCPMCNIKIHETQPL CCCCCCCEEEECCHH | 24.82 | 28112733 | |
| 99 | Ubiquitination | TQPLLNLKLDRVMQD CCHHHHCCHHHHHHH | 47.47 | 21906983 | |
| 99 (in isoform 1) | Ubiquitination | - | 47.47 | 21890473 | |
| 109 | Phosphorylation | RVMQDIVYKLVPGLQ HHHHHHHHHHCCCCC | 10.03 | 15620699 | |
| 118 | Phosphorylation | LVPGLQDSEEKRIRE HCCCCCCCHHHHHHH | 34.39 | 21815630 | |
| 121 | Ubiquitination | GLQDSEEKRIREFYQ CCCCCHHHHHHHHHH | 49.42 | 27667366 | |
| 146 | Phosphorylation | TGEEPALSNLGLPFS CCCCCCHHHCCCCCC | 31.92 | - | |
| 158 | Phosphorylation | PFSSFDHSKAHYYRY CCCCCCCCHHHHHCH | 33.12 | 20068231 | |
| 159 | Ubiquitination | FSSFDHSKAHYYRYD CCCCCCCHHHHHCHH | 35.44 | 21890473 | |
| 159 (in isoform 1) | Ubiquitination | - | 35.44 | 21890473 | |
| 184 | Ubiquitination | SSGKDKNKSVLQNKY HCCCCCCHHHHCCCC | 47.91 | 27667366 | |
| 190 | Ubiquitination | NKSVLQNKYVRCSVR CHHHHCCCCCHHHHH | 31.96 | 22817900 | |
| 190 (in isoform 1) | Ubiquitination | - | 31.96 | 21890473 | |
| 195 | Phosphorylation | QNKYVRCSVRAEVRH CCCCCHHHHHHHHHH | 12.22 | 22817900 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PCGF1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PCGF1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PCGF1_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
