| UniProt ID | RL35_MOUSE | |
|---|---|---|
| UniProt AC | Q6ZWV7 | |
| Protein Name | 60S ribosomal protein L35 | |
| Gene Name | Rpl35 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 123 | |
| Subcellular Localization | ||
| Protein Description | Component of the large ribosomal subunit.. | |
| Protein Sequence | MAKIKARDLRGKKKEELLKQLDDLKVELSQLRVAKVTGGAASKLSKIRVVRKSIARVLTVINQTQKENLRKFYKGKKYKPLDLRPKKTRAMRRRLTKHEEKLKTKKQQRKERLYPLRKYAVKA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 5 | Acetylation | ---MAKIKARDLRGK ---CCCCHHHHCCCH | 36.34 | 15607561 | |
| 19 | Acetylation | KKKEELLKQLDDLKV HHHHHHHHHHHHHHH | 62.53 | - | |
| 25 | Ubiquitination | LKQLDDLKVELSQLR HHHHHHHHHHHHHHH | 40.43 | 22790023 | |
| 25 | Acetylation | LKQLDDLKVELSQLR HHHHHHHHHHHHHHH | 40.43 | 23201123 | |
| 29 | Phosphorylation | DDLKVELSQLRVAKV HHHHHHHHHHHHHHH | 17.42 | 28066266 | |
| 43 | Acetylation | VTGGAASKLSKIRVV HHCCHHHHHHHHHHH | 52.64 | 22733758 | |
| 43 | Ubiquitination | VTGGAASKLSKIRVV HHCCHHHHHHHHHHH | 52.64 | 27667366 | |
| 43 | Malonylation | VTGGAASKLSKIRVV HHCCHHHHHHHHHHH | 52.64 | 26320211 | |
| 45 | Phosphorylation | GGAASKLSKIRVVRK CCHHHHHHHHHHHHH | 29.76 | 29514104 | |
| 53 | Phosphorylation | KIRVVRKSIARVLTV HHHHHHHHHHHHHHH | 15.77 | 29550500 | |
| 59 | Phosphorylation | KSIARVLTVINQTQK HHHHHHHHHHHHHHH | 19.24 | 29550500 | |
| 66 | Ubiquitination | TVINQTQKENLRKFY HHHHHHHHHHHHHHH | 52.54 | 22790023 | |
| 79 | Ubiquitination | FYKGKKYKPLDLRPK HHCCCCCCCCCCCCH | 48.24 | 27667366 | |
| 97 | Acetylation | AMRRRLTKHEEKLKT HHHHHHHHHHHHHHH | 54.32 | 23201123 | |
| 101 | Acetylation | RLTKHEEKLKTKKQQ HHHHHHHHHHHHHHH | 52.91 | 23864654 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RL35_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RL35_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RL35_MOUSE !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...