UniProt ID | RL35_MOUSE | |
---|---|---|
UniProt AC | Q6ZWV7 | |
Protein Name | 60S ribosomal protein L35 | |
Gene Name | Rpl35 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 123 | |
Subcellular Localization | ||
Protein Description | Component of the large ribosomal subunit.. | |
Protein Sequence | MAKIKARDLRGKKKEELLKQLDDLKVELSQLRVAKVTGGAASKLSKIRVVRKSIARVLTVINQTQKENLRKFYKGKKYKPLDLRPKKTRAMRRRLTKHEEKLKTKKQQRKERLYPLRKYAVKA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Acetylation | ---MAKIKARDLRGK ---CCCCHHHHCCCH | 36.34 | 15607561 | |
19 | Acetylation | KKKEELLKQLDDLKV HHHHHHHHHHHHHHH | 62.53 | - | |
25 | Ubiquitination | LKQLDDLKVELSQLR HHHHHHHHHHHHHHH | 40.43 | 22790023 | |
25 | Acetylation | LKQLDDLKVELSQLR HHHHHHHHHHHHHHH | 40.43 | 23201123 | |
29 | Phosphorylation | DDLKVELSQLRVAKV HHHHHHHHHHHHHHH | 17.42 | 28066266 | |
43 | Acetylation | VTGGAASKLSKIRVV HHCCHHHHHHHHHHH | 52.64 | 22733758 | |
43 | Ubiquitination | VTGGAASKLSKIRVV HHCCHHHHHHHHHHH | 52.64 | 27667366 | |
43 | Malonylation | VTGGAASKLSKIRVV HHCCHHHHHHHHHHH | 52.64 | 26320211 | |
45 | Phosphorylation | GGAASKLSKIRVVRK CCHHHHHHHHHHHHH | 29.76 | 29514104 | |
53 | Phosphorylation | KIRVVRKSIARVLTV HHHHHHHHHHHHHHH | 15.77 | 29550500 | |
59 | Phosphorylation | KSIARVLTVINQTQK HHHHHHHHHHHHHHH | 19.24 | 29550500 | |
66 | Ubiquitination | TVINQTQKENLRKFY HHHHHHHHHHHHHHH | 52.54 | 22790023 | |
79 | Ubiquitination | FYKGKKYKPLDLRPK HHCCCCCCCCCCCCH | 48.24 | 27667366 | |
97 | Acetylation | AMRRRLTKHEEKLKT HHHHHHHHHHHHHHH | 54.32 | 23201123 | |
101 | Acetylation | RLTKHEEKLKTKKQQ HHHHHHHHHHHHHHH | 52.91 | 23864654 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RL35_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RL35_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RL35_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...