UBIM_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: UBIM_HUMAN
• UniProt AC: P35544
• Protein Name: Ubiquitin-like protein FUBI
• Gene Name: FAU
• Organism: Homo sapiens (Human).
• Sequence Length: 74
• Protein Sequence: MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCGVEALTTLEVAGRMLGG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
12	Phosphorylation	VRAQELHTFEVTGQE EECEECEEEEECCCH	33.83	24043423
16	Phosphorylation	ELHTFEVTGQETVAQ ECEEEEECCCHHHHH	26.42	24043423
20	Phosphorylation	FEVTGQETVAQIKAH EEECCCHHHHHHHHH	17.16	24043423
75	Ubiquitination	AGRMLGG-------- HHHHHCC--------		29967540
92	Ubiquitination	------------------------- -------------------------		33845483
125	Acetylation	---------------------------------------------------------- ----------------------------------------------------------		19608861
125	Ubiquitination	---------------------------------------------------------- ----------------------------------------------------------		27667366
126	Ubiquitination	----------------------------------------------------------- -----------------------------------------------------------		16196087

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of UBIM_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of UBIM_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of UBIM_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CSN6_HUMAN	COPS6	physical	16169070
RS6_HUMAN	RPS6	physical	22939629
RS9_HUMAN	RPS9	physical	22939629
IL7RA_HUMAN	IL7R	physical	23151878
TAF7_HUMAN	TAF7	physical	21988832
BYST_HUMAN	BYSL	physical	22863883
DYL1_HUMAN	DYNLL1	physical	22863883
G3BP1_HUMAN	G3BP1	physical	22863883
RSSA_HUMAN	RPSA	physical	22863883
PA2G4_HUMAN	PA2G4	physical	22863883
PNO1_HUMAN	PNO1	physical	22863883
PTBP1_HUMAN	PTBP1	physical	22863883
RS13_HUMAN	RPS13	physical	22863883
RS15A_HUMAN	RPS15A	physical	22863883
RS16_HUMAN	RPS16	physical	22863883
RS17_HUMAN	RPS17	physical	22863883
RS18_HUMAN	RPS18	physical	22863883
RS19_HUMAN	RPS19	physical	22863883
RS20_HUMAN	RPS20	physical	22863883
RS24_HUMAN	RPS24	physical	22863883
RS25_HUMAN	RPS25	physical	22863883
RS26_HUMAN	RPS26	physical	22863883
RS27_HUMAN	RPS27	physical	22863883
RS27L_HUMAN	RPS27L	physical	22863883
RS28_HUMAN	RPS28	physical	22863883
RS3_HUMAN	RPS3	physical	22863883
RS4X_HUMAN	RPS4X	physical	22863883
RS6_HUMAN	RPS6	physical	22863883
RS7_HUMAN	RPS7	physical	22863883
RS9_HUMAN	RPS9	physical	22863883
SPTN1_HUMAN	SPTAN1	physical	22863883
TSR1_HUMAN	TSR1	physical	22863883
RL12_HUMAN	RPL12	physical	26344197
RL13_HUMAN	RPL13	physical	26344197
RS15_HUMAN	RPS15	physical	26344197
RS6_HUMAN	RPS6	physical	26344197

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.