UniProt ID | WDR55_HUMAN | |
---|---|---|
UniProt AC | Q9H6Y2 | |
Protein Name | WD repeat-containing protein 55 | |
Gene Name | WDR55 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 383 | |
Subcellular Localization | Nucleus, nucleolus. Cytoplasm. | |
Protein Description | Nucleolar protein that acts as a modulator of rRNA synthesis. Plays a central role during organogenesis (By similarity).. | |
Protein Sequence | MDRTCEERPAEDGSDEEDPDSMEAPTRIRDTPEDIVLEAPASGLAFHPARDLLAAGDVDGDVFVFSYSCQEGETKELWSSGHHLKACRAVAFSEDGQKLITVSKDKAIHVLDVEQGQLERRVSKAHGAPINSLLLVDENVLATGDDTGGICLWDQRKEGPLMDMRQHEEYIADMALDPAKKLLLTASGDGCLGIFNIKRRRFELLSEPQSGDLTSVTLMKWGKKVACGSSEGTIYLFNWNGFGATSDRFALRAESIDCMVPVTESLLCTGSTDGVIRAVNILPNRVVGSVGQHTGEPVEELALSHCGRFLASSGHDQRLKFWDMAQLRAVVVDDYRRRKKKGGPLRALSSKTWSTDDFFAGLREEGEDSMAQEEKEETGDDSD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | Phosphorylation | ----MDRTCEERPAE ----CCCCCCCCCCC | 21.72 | 23927012 | |
14 | Phosphorylation | ERPAEDGSDEEDPDS CCCCCCCCCCCCCCC | 54.92 | 22167270 | |
21 | Phosphorylation | SDEEDPDSMEAPTRI CCCCCCCCCCCCCCC | 24.74 | 30278072 | |
26 | Phosphorylation | PDSMEAPTRIRDTPE CCCCCCCCCCCCCCC | 45.86 | 23927012 | |
31 | Phosphorylation | APTRIRDTPEDIVLE CCCCCCCCCCCEEEE | 20.80 | 30108239 | |
85 | Ubiquitination | WSSGHHLKACRAVAF HHCCCHHHHEEEEEE | 40.87 | - | |
93 | Phosphorylation | ACRAVAFSEDGQKLI HEEEEEECCCCCEEE | 25.66 | 20068231 | |
98 | Ubiquitination | AFSEDGQKLITVSKD EECCCCCEEEEEECC | 47.59 | - | |
102 (in isoform 2) | Ubiquitination | - | 5.47 | 21890473 | |
104 | Ubiquitination | QKLITVSKDKAIHVL CEEEEEECCCEEEEE | 59.93 | - | |
104 | 2-Hydroxyisobutyrylation | QKLITVSKDKAIHVL CEEEEEECCCEEEEE | 59.93 | - | |
106 | 2-Hydroxyisobutyrylation | LITVSKDKAIHVLDV EEEEECCCEEEEEEC | 53.64 | - | |
106 | Ubiquitination | LITVSKDKAIHVLDV EEEEECCCEEEEEEC | 53.64 | - | |
157 | Ubiquitination | ICLWDQRKEGPLMDM EECEECCCCCCCCCH | 62.48 | - | |
180 | Ubiquitination | DMALDPAKKLLLTAS HHHCCHHHHHHHEEC | 49.71 | - | |
255 | Phosphorylation | RFALRAESIDCMVPV CCHHHHHHCCEEEEC | 23.81 | 27251275 | |
289 | Phosphorylation | LPNRVVGSVGQHTGE CCCCEEEECCCCCCC | 16.09 | 27080861 | |
294 | Phosphorylation | VGSVGQHTGEPVEEL EEECCCCCCCCHHHH | 35.04 | 27080861 | |
304 | Phosphorylation | PVEELALSHCGRFLA CHHHHHHHHHHHHHH | 15.89 | 27080861 | |
320 | Ubiquitination | SGHDQRLKFWDMAQL CCCCHHHHHHHHHHH | 46.74 | 21890473 | |
320 (in isoform 1) | Ubiquitination | - | 46.74 | 21890473 | |
351 | Ubiquitination | PLRALSSKTWSTDDF CCHHHCCCCCCCCCC | 51.11 | - | |
352 | Phosphorylation | LRALSSKTWSTDDFF CHHHCCCCCCCCCCH | 26.96 | 27080861 | |
354 | Phosphorylation | ALSSKTWSTDDFFAG HHCCCCCCCCCCHHH | 27.47 | 27732954 | |
355 | Phosphorylation | LSSKTWSTDDFFAGL HCCCCCCCCCCHHHH | 31.02 | 27080861 | |
369 | Phosphorylation | LREEGEDSMAQEEKE HHHCCCCCCCHHHHH | 16.24 | 18669648 | |
378 | Phosphorylation | AQEEKEETGDDSD-- CHHHHHHHCCCCC-- | 47.18 | 30278072 | |
382 | Phosphorylation | KEETGDDSD------ HHHHCCCCC------ | 50.38 | 30278072 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of WDR55_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of WDR55_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of WDR55_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PP4R2_HUMAN | PPP4R2 | physical | 26344197 | |
MCMBP_HUMAN | MCMBP | physical | 28514442 | |
BOP1_HUMAN | BOP1 | physical | 28514442 | |
RL7L_HUMAN | RPL7L1 | physical | 28514442 | |
KLDC3_HUMAN | KLHDC3 | physical | 28514442 | |
LENG8_HUMAN | LENG8 | physical | 28514442 | |
WDR12_HUMAN | WDR12 | physical | 28514442 | |
SPB1_HUMAN | FTSJ3 | physical | 28514442 | |
REXO5_HUMAN | LOC81691 | physical | 28514442 | |
RL3_HUMAN | RPL3 | physical | 28514442 | |
CNDH2_HUMAN | NCAPH2 | physical | 28514442 | |
PESC_HUMAN | PES1 | physical | 28514442 | |
JPH1_HUMAN | JPH1 | physical | 28514442 | |
NOC3L_HUMAN | NOC3L | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Quantitative phosphoproteomic analysis of T cell receptor signalingreveals system-wide modulation of protein-protein interactions."; Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,Rodionov V., Han D.K.; Sci. Signal. 2:RA46-RA46(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-14, AND MASSSPECTROMETRY. | |
"A quantitative atlas of mitotic phosphorylation."; Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-14; THR-378 AND SER-382,AND MASS SPECTROMETRY. |