UniProt ID | KLDC3_HUMAN | |
---|---|---|
UniProt AC | Q9BQ90 | |
Protein Name | Kelch domain-containing protein 3 | |
Gene Name | KLHDC3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 382 | |
Subcellular Localization | Cytoplasm. Also found in meiotic chromatin.. | |
Protein Description | May be involved in meiotic recombination process.. | |
Protein Sequence | MLRWTVHLEGGPRRVNHAAVAVGHRVYSFGGYCSGEDYETLRQIDVHIFNAVSLRWTKLPPVKSAIRGQAPVVPYMRYGHSTVLIDDTVLLWGGRNDTEGACNVLYAFDVNTHKWFTPRVSGTVPGARDGHSACVLGKIMYIFGGYEQQADCFSNDIHKLDTSTMTWTLICTKGSPARWRDFHSATMLGSHMYVFGGRADRFGPFHSNNEIYCNRIRVFDTRTEAWLDCPPTPVLPEGRRSHSAFGYNGELYIFGGYNARLNRHFHDLWKFNPVSFTWKKIEPKGKGPCPRRRQCCCIVGDKIVLFGGTSPSPEEGLGDEFDLIDHSDLHILDFSPSLKTLCKLAVIQYNLDQSCLPHDIRWELNAMTTNSNISRPIVSSHG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Phosphorylation | ---MLRWTVHLEGGP ---CCCEEEEECCCC | 7.51 | 17322306 | |
57 | Phosphorylation | NAVSLRWTKLPPVKS ECCCCCCCCCCCCCH | 19.10 | 23898821 | |
63 | Ubiquitination | WTKLPPVKSAIRGQA CCCCCCCCHHHCCCC | 39.69 | 29901268 | |
67 | Methylation | PPVKSAIRGQAPVVP CCCCHHHCCCCCCCC | 30.78 | 115481341 | |
114 | Ubiquitination | AFDVNTHKWFTPRVS EEECCCCEEECCCCC | 41.80 | - | |
286 | Sumoylation | KKIEPKGKGPCPRRR EECCCCCCCCCCCCC | 66.85 | - | |
339 | Ubiquitination | LDFSPSLKTLCKLAV EECCHHHHHHHHHHH | 43.73 | 29967540 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KLDC3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KLDC3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KLDC3_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...