| UniProt ID | KLDC3_HUMAN | |
|---|---|---|
| UniProt AC | Q9BQ90 | |
| Protein Name | Kelch domain-containing protein 3 | |
| Gene Name | KLHDC3 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 382 | |
| Subcellular Localization | Cytoplasm. Also found in meiotic chromatin.. | |
| Protein Description | May be involved in meiotic recombination process.. | |
| Protein Sequence | MLRWTVHLEGGPRRVNHAAVAVGHRVYSFGGYCSGEDYETLRQIDVHIFNAVSLRWTKLPPVKSAIRGQAPVVPYMRYGHSTVLIDDTVLLWGGRNDTEGACNVLYAFDVNTHKWFTPRVSGTVPGARDGHSACVLGKIMYIFGGYEQQADCFSNDIHKLDTSTMTWTLICTKGSPARWRDFHSATMLGSHMYVFGGRADRFGPFHSNNEIYCNRIRVFDTRTEAWLDCPPTPVLPEGRRSHSAFGYNGELYIFGGYNARLNRHFHDLWKFNPVSFTWKKIEPKGKGPCPRRRQCCCIVGDKIVLFGGTSPSPEEGLGDEFDLIDHSDLHILDFSPSLKTLCKLAVIQYNLDQSCLPHDIRWELNAMTTNSNISRPIVSSHG | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 5 | Phosphorylation | ---MLRWTVHLEGGP ---CCCEEEEECCCC | 7.51 | 17322306 | |
| 57 | Phosphorylation | NAVSLRWTKLPPVKS ECCCCCCCCCCCCCH | 19.10 | 23898821 | |
| 63 | Ubiquitination | WTKLPPVKSAIRGQA CCCCCCCCHHHCCCC | 39.69 | 29901268 | |
| 67 | Methylation | PPVKSAIRGQAPVVP CCCCHHHCCCCCCCC | 30.78 | 115481341 | |
| 114 | Ubiquitination | AFDVNTHKWFTPRVS EEECCCCEEECCCCC | 41.80 | - | |
| 286 | Sumoylation | KKIEPKGKGPCPRRR EECCCCCCCCCCCCC | 66.85 | - | |
| 339 | Ubiquitination | LDFSPSLKTLCKLAV EECCHHHHHHHHHHH | 43.73 | 29967540 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KLDC3_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KLDC3_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KLDC3_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...