| UniProt ID | HMCES_HUMAN | |
|---|---|---|
| UniProt AC | Q96FZ2 | |
| Protein Name | Embryonic stem cell-specific 5-hydroxymethylcytosine-binding protein | |
| Gene Name | HMCES | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 354 | |
| Subcellular Localization | ||
| Protein Description | Specifically binds 5-hydroxymethylcytosine (5hmC)-containing DNA in stem cells, suggesting that it acts as a specific reader of 5hmC in stem cells (By similarity). May act as a peptidase; experimental evidences are however required to confirm this prediction. [PubMed: 23945014] | |
| Protein Sequence | MCGRTSCHLPRDVLTRACAYQDRRGQQRLPEWRDPDKYCPSYNKSPQSNSPVLLSRLHFEKDADSSERIIAPMRWGLVPSWFKESDPSKLQFNTTNCRSDTVMEKRSFKVPLGKGRRCVVLADGFYEWQRCQGTNQRQPYFIYFPQIKTEKSGSIGAADSPENWEKVWDNWRLLTMAGIFDCWEPPEGGDVLYSYTIITVDSCKGLSDIHHRMPAILDGEEAVSKWLDFGEVSTQEALKLIHPTENITFHAVSSVVNNSRNNTPECLAPVDLVVKKELRASGSSQRMLQWLATKSPKKEDSKTPQKEESDVPQWSSQFLQKSPLPTKRGTAGLLEQWLKREKEEEPVAKRPYSQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Other | ------MCGRTSCHL ------CCCCCCCCC | 31235913 | ||
| 20 | Phosphorylation | VLTRACAYQDRRGQQ HHHHHHHHHCCCCCC | 29496907 | ||
| 37 | Acetylation | PEWRDPDKYCPSYNK CCCCCCCCCCCCCCC | 27452117 | ||
| 37 | Ubiquitination | PEWRDPDKYCPSYNK CCCCCCCCCCCCCCC | 29967540 | ||
| 38 | Phosphorylation | EWRDPDKYCPSYNKS CCCCCCCCCCCCCCC | 20873877 | ||
| 41 | Phosphorylation | DPDKYCPSYNKSPQS CCCCCCCCCCCCCCC | 20873877 | ||
| 42 | Phosphorylation | PDKYCPSYNKSPQSN CCCCCCCCCCCCCCC | 20873877 | ||
| 44 | Ubiquitination | KYCPSYNKSPQSNSP CCCCCCCCCCCCCCC | 21906983 | ||
| 45 | Phosphorylation | YCPSYNKSPQSNSPV CCCCCCCCCCCCCCC | 25159151 | ||
| 48 | Phosphorylation | SYNKSPQSNSPVLLS CCCCCCCCCCCCEEE | 20873877 | ||
| 50 | Phosphorylation | NKSPQSNSPVLLSRL CCCCCCCCCCEEEEE | 20873877 | ||
| 55 | Phosphorylation | SNSPVLLSRLHFEKD CCCCCEEEEEEEECC | 20873877 | ||
| 61 | Ubiquitination | LSRLHFEKDADSSER EEEEEEECCCCCCCE | 21906983 | ||
| 83 | Ubiquitination | GLVPSWFKESDPSKL CCCCHHHHCCCHHHC | 83 | ||
| 85 | Phosphorylation | VPSWFKESDPSKLQF CCHHHHCCCHHHCEE | - | ||
| 88 | Phosphorylation | WFKESDPSKLQFNTT HHHCCCHHHCEEECC | - | ||
| 89 | Sumoylation | FKESDPSKLQFNTTN HHCCCHHHCEEECCC | - | ||
| 89 | Ubiquitination | FKESDPSKLQFNTTN HHCCCHHHCEEECCC | 27667366 | ||
| 89 | Sumoylation | FKESDPSKLQFNTTN HHCCCHHHCEEECCC | - | ||
| 105 | Ubiquitination | RSDTVMEKRSFKVPL CCCCCEEEEEEECCC | 21906983 | ||
| 105 | Acetylation | RSDTVMEKRSFKVPL CCCCCEEEEEEECCC | 25953088 | ||
| 109 | Ubiquitination | VMEKRSFKVPLGKGR CEEEEEEECCCCCCC | 22817900 | ||
| 124 | Ubiquitination | RCVVLADGFYEWQRC EEEEECCCCEEEECC | 21963094 | ||
| 148 | Sumoylation | FIYFPQIKTEKSGSI EEEECEEECCCCCCC | - | ||
| 148 | Sumoylation | FIYFPQIKTEKSGSI EEEECEEECCCCCCC | 28112733 | ||
| 148 | Ubiquitination | FIYFPQIKTEKSGSI EEEECEEECCCCCCC | 22817900 | ||
| 151 | Sumoylation | FPQIKTEKSGSIGAA ECEEECCCCCCCCCC | 28112733 | ||
| 151 | Ubiquitination | FPQIKTEKSGSIGAA ECEEECCCCCCCCCC | 21906983 | ||
| 152 | Phosphorylation | PQIKTEKSGSIGAAD CEEECCCCCCCCCCC | 25627689 | ||
| 154 | Phosphorylation | IKTEKSGSIGAADSP EECCCCCCCCCCCCH | 25627689 | ||
| 160 | Phosphorylation | GSIGAADSPENWEKV CCCCCCCCHHHHHHH | 25159151 | ||
| 166 | Ubiquitination | DSPENWEKVWDNWRL CCHHHHHHHHHHHHE | 21906983 | ||
| 207 | Phosphorylation | VDSCKGLSDIHHRMP ECCCCCCCCHHHHCC | - | ||
| 225 | Ubiquitination | DGEEAVSKWLDFGEV CCHHHHHHHCCCCCC | 29967540 | ||
| 233 | Ubiquitination | WLDFGEVSTQEALKL HCCCCCCCHHHHHHH | 21963094 | ||
| 234 | Ubiquitination | LDFGEVSTQEALKLI CCCCCCCHHHHHHHH | 22817900 | ||
| 263 | Phosphorylation | VNNSRNNTPECLAPV HHCCCCCCCCCCCCC | 25850435 | ||
| 273 | Ubiquitination | CLAPVDLVVKKELRA CCCCCEEEEEHHHHH | 32015554 | ||
| 275 | Sumoylation | APVDLVVKKELRASG CCCEEEEEHHHHHCC | - | ||
| 275 | Ubiquitination | APVDLVVKKELRASG CCCEEEEEHHHHHCC | 21963094 | ||
| 275 | Sumoylation | APVDLVVKKELRASG CCCEEEEEHHHHHCC | 28112733 | ||
| 276 | Sumoylation | PVDLVVKKELRASGS CCEEEEEHHHHHCCC | 28112733 | ||
| 276 | Ubiquitination | PVDLVVKKELRASGS CCEEEEEHHHHHCCC | 22817900 | ||
| 279 | Ubiquitination | LVVKKELRASGSSQR EEEEHHHHHCCCHHH | 22817900 | ||
| 281 | Phosphorylation | VKKELRASGSSQRML EEHHHHHCCCHHHHH | 26074081 | ||
| 283 | Phosphorylation | KELRASGSSQRMLQW HHHHHCCCHHHHHHH | 26074081 | ||
| 284 | Phosphorylation | ELRASGSSQRMLQWL HHHHCCCHHHHHHHH | 26074081 | ||
| 285 | Ubiquitination | LRASGSSQRMLQWLA HHHCCCHHHHHHHHH | 27667366 | ||
| 291 | Ubiquitination | SQRMLQWLATKSPKK HHHHHHHHHCCCCCC | 32015554 | ||
| 293 | Phosphorylation | RMLQWLATKSPKKED HHHHHHHCCCCCCCC | 27987026 | ||
| 294 | Acetylation | MLQWLATKSPKKEDS HHHHHHCCCCCCCCC | 25953088 | ||
| 295 | Phosphorylation | LQWLATKSPKKEDSK HHHHHCCCCCCCCCC | 23927012 | ||
| 297 | Ubiquitination | WLATKSPKKEDSKTP HHHCCCCCCCCCCCC | 32015554 | ||
| 301 | Phosphorylation | KSPKKEDSKTPQKEE CCCCCCCCCCCCHHH | 26074081 | ||
| 303 | Phosphorylation | PKKEDSKTPQKEESD CCCCCCCCCCHHHCC | 30576142 | ||
| 306 | Sumoylation | EDSKTPQKEESDVPQ CCCCCCCHHHCCCCH | - | ||
| 306 | Sumoylation | EDSKTPQKEESDVPQ CCCCCCCHHHCCCCH | 28112733 | ||
| 306 | Ubiquitination | EDSKTPQKEESDVPQ CCCCCCCHHHCCCCH | 29967540 | ||
| 307 | Ubiquitination | DSKTPQKEESDVPQW CCCCCCHHHCCCCHH | 24816145 | ||
| 309 | Phosphorylation | KTPQKEESDVPQWSS CCCCHHHCCCCHHHH | 30576142 | ||
| 315 | Phosphorylation | ESDVPQWSSQFLQKS HCCCCHHHHHHHHHC | 29978859 | ||
| 316 | Phosphorylation | SDVPQWSSQFLQKSP CCCCHHHHHHHHHCC | 29978859 | ||
| 321 | Ubiquitination | WSSQFLQKSPLPTKR HHHHHHHHCCCCCCC | 22817900 | ||
| 322 | Phosphorylation | SSQFLQKSPLPTKRG HHHHHHHCCCCCCCC | 30266825 | ||
| 326 | Phosphorylation | LQKSPLPTKRGTAGL HHHCCCCCCCCHHHH | 28634298 | ||
| 327 | Ubiquitination | QKSPLPTKRGTAGLL HHCCCCCCCCHHHHH | 27667366 | ||
| 327 | Acetylation | QKSPLPTKRGTAGLL HHCCCCCCCCHHHHH | 25953088 | ||
| 330 | Phosphorylation | PLPTKRGTAGLLEQW CCCCCCCHHHHHHHH | 22617229 | ||
| 339 | Ubiquitination | GLLEQWLKREKEEEP HHHHHHHHHHHHCCC | 32015554 | ||
| 339 | Sumoylation | GLLEQWLKREKEEEP HHHHHHHHHHHHCCC | - | ||
| 339 | Sumoylation | GLLEQWLKREKEEEP HHHHHHHHHHHHCCC | 28112733 | ||
| 342 | Sumoylation | EQWLKREKEEEPVAK HHHHHHHHHCCCCCC | - | ||
| 342 | Sumoylation | EQWLKREKEEEPVAK HHHHHHHHHCCCCCC | 28112733 | ||
| 349 | Ubiquitination | KEEEPVAKRPYSQ-- HHCCCCCCCCCCC-- | 24816145 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HMCES_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HMCES_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HMCES_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| A4_HUMAN | APP | physical | 21832049 | |
| HSP7C_HUMAN | HSPA8 | physical | 28514442 | |
| HPBP1_HUMAN | HSPBP1 | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
