| UniProt ID | HPBP1_HUMAN | |
|---|---|---|
| UniProt AC | Q9NZL4 | |
| Protein Name | Hsp70-binding protein 1 | |
| Gene Name | HSPBP1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 362 | |
| Subcellular Localization | ||
| Protein Description | Inhibits HSPA1A chaperone activity by changing the conformation of the ATP-binding domain of HSPA1A and interfering with ATP binding. Interferes with ubiquitination mediated by STUB1 and inhibits chaperone-assisted degradation of immature CFTR.. | |
| Protein Sequence | MSDEGSRGSRLPLALPPASQGCSSGGGGGGGGGSSAGGSGNSRPPRNLQGLLQMAITAGSEEPDPPPEPMSEERRQWLQEAMSAAFRGQREEVEQMKSCLRVLSQPMPPTAGEAEQAADQQEREGALELLADLCENMDNAADFCQLSGMHLLVGRYLEAGAAGLRWRAAQLIGTCSQNVAAIQEQVLGLGALRKLLRLLDRDACDTVRVKALFAISCLVREQEAGLLQFLRLDGFSVLMRAMQQQVQKLKVKSAFLLQNLLVGHPEHKGTLCSMGMVQQLVALVRTEHSPFHEHVLGALCSLVTDFPQGVRECREPELGLEELLRHRCQLLQQHEEYQEELEFCEKLLQTCFSSPADDSMDR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSDEGSRGS ------CCCCCCCCC | 44.35 | 22210691 | |
| 9 | Phosphorylation | SDEGSRGSRLPLALP CCCCCCCCCCCCCCC | 29.54 | - | |
| 19 | Phosphorylation | PLALPPASQGCSSGG CCCCCCHHHCCCCCC | 32.64 | 22210691 | |
| 24 | Phosphorylation | PASQGCSSGGGGGGG CHHHCCCCCCCCCCC | 45.60 | 28555341 | |
| 34 | Phosphorylation | GGGGGGGSSAGGSGN CCCCCCCCCCCCCCC | 21.93 | 21712546 | |
| 35 | Phosphorylation | GGGGGGSSAGGSGNS CCCCCCCCCCCCCCC | 33.92 | 22210691 | |
| 36 | Phosphorylation | GGGGGSSAGGSGNSR CCCCCCCCCCCCCCC | 28.23 | - | |
| 39 | Phosphorylation | GGSSAGGSGNSRPPR CCCCCCCCCCCCCCC | 33.61 | 21712546 | |
| 42 | Phosphorylation | SAGGSGNSRPPRNLQ CCCCCCCCCCCCCHH | 50.09 | 28555341 | |
| 54 | Phosphorylation | NLQGLLQMAITAGSE CHHHHHHHHHHCCCC | 2.69 | 27251275 | |
| 57 | Phosphorylation | GLLQMAITAGSEEPD HHHHHHHHCCCCCCC | 18.54 | 28348404 | |
| 60 | Phosphorylation | QMAITAGSEEPDPPP HHHHHCCCCCCCCCC | 36.00 | 28348404 | |
| 83 | Phosphorylation | QWLQEAMSAAFRGQR HHHHHHHHHHHHCCH | 24.40 | - | |
| 94 | Ubiquitination | RGQREEVEQMKSCLR HCCHHHHHHHHHHHH | 48.51 | 27667366 | |
| 97 | Acetylation | REEVEQMKSCLRVLS HHHHHHHHHHHHHHC | 37.40 | 25953088 | |
| 97 | Ubiquitination | REEVEQMKSCLRVLS HHHHHHHHHHHHHHC | 37.40 | - | |
| 107 | Sulfoxidation | LRVLSQPMPPTAGEA HHHHCCCCCCCCCHH | 4.87 | 21406390 | |
| 140 | Ubiquitination | LCENMDNAADFCQLS HHHCCCCHHHHHHHH | 12.25 | 27667366 | |
| 156 | Phosphorylation | MHLLVGRYLEAGAAG HHHHHHHHHHHHHHH | 11.72 | 20068231 | |
| 162 | Methylation | RYLEAGAAGLRWRAA HHHHHHHHHHHHHHH | 19.35 | - | |
| 165 | Methylation | EAGAAGLRWRAAQLI HHHHHHHHHHHHHHH | 21.66 | 115479993 | |
| 206 | Phosphorylation | LDRDACDTVRVKALF HCCCCCHHHHHHHHH | 15.31 | - | |
| 207 | Ubiquitination | DRDACDTVRVKALFA CCCCCHHHHHHHHHH | 4.18 | 33845483 | |
| 210 | Ubiquitination | ACDTVRVKALFAISC CCHHHHHHHHHHHHH | 28.89 | - | |
| 233 | Phosphorylation | LLQFLRLDGFSVLMR HHHHHHCCHHHHHHH | 50.05 | - | |
| 236 | Phosphorylation | FLRLDGFSVLMRAMQ HHHCCHHHHHHHHHH | 21.63 | 21406692 | |
| 239 | Sulfoxidation | LDGFSVLMRAMQQQV CCHHHHHHHHHHHHH | 2.11 | 21406390 | |
| 245 | Ubiquitination | LMRAMQQQVQKLKVK HHHHHHHHHHHHHHH | 23.79 | 21890473 | |
| 248 | Malonylation | AMQQQVQKLKVKSAF HHHHHHHHHHHHHHH | 51.96 | 26320211 | |
| 248 | Acetylation | AMQQQVQKLKVKSAF HHHHHHHHHHHHHHH | 51.96 | 25953088 | |
| 248 | Ubiquitination | AMQQQVQKLKVKSAF HHHHHHHHHHHHHHH | 51.96 | 21890473 | |
| 249 | Ubiquitination | MQQQVQKLKVKSAFL HHHHHHHHHHHHHHH | 4.27 | - | |
| 250 | Ubiquitination | QQQVQKLKVKSAFLL HHHHHHHHHHHHHHH | 55.44 | - | |
| 253 | Ubiquitination | VQKLKVKSAFLLQNL HHHHHHHHHHHHHHH | 27.52 | 33845483 | |
| 291 (in isoform 1) | Ubiquitination | - | 13.64 | 21890473 | |
| 291 | Ubiquitination | VRTEHSPFHEHVLGA HHCCCCHHHHHHHHH | 13.64 | 21890473 | |
| 291 | Ubiquitination | VRTEHSPFHEHVLGA HHCCCCHHHHHHHHH | 13.64 | 21890473 | |
| 350 | Phosphorylation | FCEKLLQTCFSSPAD HHHHHHHHHHCCCCC | 18.58 | 30266825 | |
| 351 | Phosphorylation | CEKLLQTCFSSPADD HHHHHHHHHCCCCCC | 1.69 | 20068231 | |
| 353 | Phosphorylation | KLLQTCFSSPADDSM HHHHHHHCCCCCCCC | 37.24 | 23401153 | |
| 354 | Phosphorylation | LLQTCFSSPADDSMD HHHHHHCCCCCCCCC | 12.12 | 29255136 | |
| 356 | Phosphorylation | QTCFSSPADDSMDR- HHHHCCCCCCCCCC- | 34.88 | 20068231 | |
| 359 | Phosphorylation | FSSPADDSMDR---- HCCCCCCCCCC---- | 24.11 | 20201521 | |
| 359 | Methylation | FSSPADDSMDR---- HCCCCCCCCCC---- | 24.11 | - | |
| 362 | Methylation | PADDSMDR------- CCCCCCCC------- | 39.54 | 115479985 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HPBP1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HPBP1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HPBP1_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A quantitative atlas of mitotic phosphorylation."; Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-354 AND SER-359, ANDMASS SPECTROMETRY. | |