| UniProt ID | PGRP1_HUMAN | |
|---|---|---|
| UniProt AC | O75594 | |
| Protein Name | Peptidoglycan recognition protein 1 | |
| Gene Name | PGLYRP1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 196 | |
| Subcellular Localization | Secreted . Cytoplasmic granule. | |
| Protein Description | Pattern receptor that binds to murein peptidoglycans (PGN) of Gram-positive bacteria. Has bactericidal activity towards Gram-positive bacteria. May kill Gram-positive bacteria by interfering with peptidoglycan biosynthesis. Binds also to Gram-negative bacteria, and has bacteriostatic activity towards Gram-negative bacteria. Plays a role in innate immunity.. | |
| Protein Sequence | MSRRSMLLAWALPSLLRLGAAQETEDPACCSPIVPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTPASCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQNWPHYRSP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 5 | Acetylation | ---MSRRSMLLAWAL ---CCHHHHHHHHHH | 16.81 | 19413330 | |
| 5 | Phosphorylation | ---MSRRSMLLAWAL ---CCHHHHHHHHHH | 16.81 | 19413330 | |
| 14 | Phosphorylation | LLAWALPSLLRLGAA HHHHHHHHHHHHCCC | 40.67 | 19413330 | |
| 22 | Pyrrolidone_carboxylic_acid | LLRLGAAQETEDPAC HHHHCCCCCCCCCCC | 58.57 | - | |
| 22 | Pyrrolidone_carboxylic_acid | LLRLGAAQETEDPAC HHHHCCCCCCCCCCC | 58.57 | - | |
| 24 | Phosphorylation | RLGAAQETEDPACCS HHCCCCCCCCCCCCC | 33.34 | 28111955 | |
| 31 | Phosphorylation | TEDPACCSPIVPRNE CCCCCCCCCCCCHHH | 19.97 | 28111955 | |
| 51 | Phosphorylation | SECAQHLSLPLRYVV HHHHHHCCCCEEEEE | 26.30 | 24719451 | |
| 112 | N-linked_Glycosylation | VYEGRGWNFTGAHSG EECCCCCCCCCCCCC | 27.68 | UniProtKB CARBOHYD |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PGRP1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PGRP1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PGRP1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| IFNA2_HUMAN | IFNA2 | physical | 26186194 | |
| CNRP1_HUMAN | CNRIP1 | physical | 26186194 | |
| IFNA2_HUMAN | IFNA2 | physical | 28514442 | |
| CNRP1_HUMAN | CNRIP1 | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
