| UniProt ID | CNRP1_HUMAN | |
|---|---|---|
| UniProt AC | Q96F85 | |
| Protein Name | CB1 cannabinoid receptor-interacting protein 1 | |
| Gene Name | CNRIP1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 164 | |
| Subcellular Localization | ||
| Protein Description | Isoform 1 suppresses cannabinoid receptor CNR1-mediated tonic inhibition of voltage-gated calcium channels. Isoform 2 does not have this effect.. | |
| Protein Sequence | MGDLPGLVRLSIALRIQPNDGPVFYKVDGQRFGQNRTIKLLTGSSYKVEVKIKPSTLQVENISIGGVLVPLELKSKEPDGDRVVYTGTYDTEGVTPTKSGERQPIQITMPFTDIGTFETVWQVKFYNYHKRDHCQWGSPFSVIEYECKPNETRSLMWVNKESFL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 42 | Phosphorylation | NRTIKLLTGSSYKVE CCEEEEECCCCEEEE | 45.51 | 25072903 | |
| 44 | Phosphorylation | TIKLLTGSSYKVEVK EEEEECCCCEEEEEE | 25.84 | 25072903 | |
| 45 | Phosphorylation | IKLLTGSSYKVEVKI EEEECCCCEEEEEEE | 30.25 | 25072903 | |
| 46 | Phosphorylation | KLLTGSSYKVEVKIK EEECCCCEEEEEEEC | 22.28 | 25072903 | |
| 85 | Phosphorylation | PDGDRVVYTGTYDTE CCCCEEEEEEEECCC | 9.15 | 27762562 | |
| 89 | Phosphorylation | RVVYTGTYDTEGVTP EEEEEEEECCCCCCC | 23.39 | 27762562 | |
| 91 | Phosphorylation | VYTGTYDTEGVTPTK EEEEEECCCCCCCCC | 24.99 | 27732954 | |
| 95 | Phosphorylation | TYDTEGVTPTKSGER EECCCCCCCCCCCCC | 35.78 | 27732954 | |
| 97 | Phosphorylation | DTEGVTPTKSGERQP CCCCCCCCCCCCCCC | 28.60 | 27732954 | |
| 152 | Phosphorylation | YECKPNETRSLMWVN EEECCCCCEEEEEEC | 32.00 | 20068231 | |
| 154 | Phosphorylation | CKPNETRSLMWVNKE ECCCCCEEEEEECCC | 29.96 | 20068231 | |
| 162 | Phosphorylation | LMWVNKESFL----- EEEECCCCCC----- | 33.20 | 20068231 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CNRP1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CNRP1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CNRP1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| KCTD5_HUMAN | KCTD5 | physical | 26186194 | |
| UTP4_HUMAN | CIRH1A | physical | 26186194 | |
| UTP4_HUMAN | CIRH1A | physical | 28514442 | |
| KCTD2_HUMAN | KCTD2 | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
