| UniProt ID | KCTD2_HUMAN | |
|---|---|---|
| UniProt AC | Q14681 | |
| Protein Name | BTB/POZ domain-containing protein KCTD2 | |
| Gene Name | KCTD2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 263 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MAELQLDPAMAGLGGGGGSGVGDGGGPVRGPPSPRPAGPTPRGHGRPAAAVAQPLEPGPGPPERAGGGGAARWVRLNVGGTYFVTTRQTLGREPKSFLCRLCCQEDPELDSDKDETGAYLIDRDPTYFGPILNYLRHGKLIITKELAEEGVLEEAEFYNIASLVRLVKERIRDNENRTSQGPVKHVYRVLQCQEEELTQMVSTMSDGWKFEQLISIGSSYNYGNEDQAEFLCVVSRELNNSTNGIVIEPSEKAKILQERGSRM | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MAELQLDPA ------CCCCCCCHH | 26.63 | 22814378 | |
| 19 | Phosphorylation | GLGGGGGSGVGDGGG CCCCCCCCCCCCCCC | 33.31 | 26074081 | |
| 33 | Phosphorylation | GPVRGPPSPRPAGPT CCCCCCCCCCCCCCC | 36.35 | 25159151 | |
| 40 | Phosphorylation | SPRPAGPTPRGHGRP CCCCCCCCCCCCCCC | 25.38 | 26074081 | |
| 96 | Phosphorylation | TLGREPKSFLCRLCC CCCCCCCCHHHHHHC | 33.88 | 24719451 | |
| 220 | Phosphorylation | LISIGSSYNYGNEDQ HEECCCCCCCCCHHH | 17.69 | - | |
| 222 | Phosphorylation | SIGSSYNYGNEDQAE ECCCCCCCCCHHHHH | 17.07 | - | |
| 252 | Ubiquitination | IVIEPSEKAKILQER EEECHHHHHHHHHHH | 60.35 | 21906983 | |
| 254 | Ubiquitination | IEPSEKAKILQERGS ECHHHHHHHHHHHHC | 55.83 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KCTD2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KCTD2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KCTD2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CUL3_HUMAN | CUL3 | physical | 28060381 | |
| MYC_HUMAN | MYC | physical | 28060381 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...