UniProt ID | POP7_HUMAN | |
---|---|---|
UniProt AC | O75817 | |
Protein Name | Ribonuclease P protein subunit p20 | |
Gene Name | POP7 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 140 | |
Subcellular Localization | Nucleus, nucleolus . Cytoplasm . Cytoplasmic granule . Under stress conditions colocalizes with SMN1 in punctuated cytoplasmic granules. | |
Protein Description | Component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends. Also a component of RNase MRP complex, which cleaves pre-rRNA sequences.. | |
Protein Sequence | MAENREPRGAVEAELDPVEYTLRKRLPSRLPRRPNDIYVNMKTDFKAQLARCQKLLDGGARGQNACSEIYIHGLGLAINRAINIALQLQAGSFGSLQVAANTSTVELVDELEPETDTREPLTRIRNNSAIHIRVFRVTPK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
20 | Phosphorylation | AELDPVEYTLRKRLP EECCHHHHHHHHCCC | 16.00 | 21552520 | |
21 | Phosphorylation | ELDPVEYTLRKRLPS ECCHHHHHHHHCCCC | 13.43 | 24719451 | |
28 | Phosphorylation | TLRKRLPSRLPRRPN HHHHCCCCCCCCCCC | 51.55 | 23898821 | |
38 | Phosphorylation | PRRPNDIYVNMKTDF CCCCCCEEECCCCCH | 6.66 | 27642862 | |
42 | Ubiquitination | NDIYVNMKTDFKAQL CCEEECCCCCHHHHH | 39.47 | 21906983 | |
46 | Methylation | VNMKTDFKAQLARCQ ECCCCCHHHHHHHHH | 37.72 | 19822891 | |
46 | Acetylation | VNMKTDFKAQLARCQ ECCCCCHHHHHHHHH | 37.72 | 27452117 | |
46 | Ubiquitination | VNMKTDFKAQLARCQ ECCCCCHHHHHHHHH | 37.72 | 27667366 | |
46 | Ubiquitination | VNMKTDFKAQLARCQ ECCCCCHHHHHHHHH | 37.72 | 21890473 | |
54 | Ubiquitination | AQLARCQKLLDGGAR HHHHHHHHHHCCCCC | 55.43 | - | |
54 | Acetylation | AQLARCQKLLDGGAR HHHHHHHHHHCCCCC | 55.43 | 26051181 | |
70 | Phosphorylation | QNACSEIYIHGLGLA CCCCCCHHHCHHHHH | 5.25 | - | |
128 | Phosphorylation | LTRIRNNSAIHIRVF CHHHHCCCCEEEEEE | 31.95 | 20873877 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of POP7_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of POP7_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of POP7_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RPP25_HUMAN | RPP25 | physical | 15096576 | |
RPP30_HUMAN | RPP30 | physical | 9630247 | |
RPP38_HUMAN | RPP38 | physical | 9630247 | |
RPP40_HUMAN | RPP40 | physical | 9630247 | |
A4_HUMAN | APP | physical | 21832049 | |
RPP40_HUMAN | RPP40 | physical | 22939629 | |
CSN6_HUMAN | COPS6 | physical | 22863883 | |
CUL4B_HUMAN | CUL4B | physical | 22863883 | |
E41L1_HUMAN | EPB41L1 | physical | 22863883 | |
SART3_HUMAN | SART3 | physical | 22863883 | |
VASP_HUMAN | VASP | physical | 22863883 | |
RP25L_HUMAN | RPP25L | physical | 25416956 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...