UniProt ID | CI114_HUMAN | |
---|---|---|
UniProt AC | Q5T280 | |
Protein Name | Putative methyltransferase C9orf114 {ECO:0000305} | |
Gene Name | SPOUT1 {ECO:0000312|HGNC:HGNC:26933} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 376 | |
Subcellular Localization | Cytoplasm, cytoskeleton, spindle . Chromosome, centromere, kinetochore . Cytoplasm, cytoskeleton, microtubule organizing center, centrosome . Associated with the outer kinetochore. | |
Protein Description | Required for association of the centrosomes with the poles of the bipolar mitotic spindle during metaphase. [PubMed: 20813266] | |
Protein Sequence | MAERGRKRPCGPGEHGQRIEWRKWKQQKKEEKKKWKDLKLMKKLERQRAQEEQAKRLEEEEAAAEKEDRGRPYTLSVALPGSILDNAQSPELRTYLAGQIARACAIFCVDEIVVFDEEGQDAKTVEGEFTGVGKKGQACVQLARILQYLECPQYLRKAFFPKHQDLQFAGLLNPLDSPHHMRQDEESEFREGIVVDRPTRPGHGSFVNCGMKKEVKIDKNLEPGLRVTVRLNQQQHPDCKTYHGKVVSSQDPRTKAGLYWGYTVRLASCLSAVFAEAPFQDGYDLTIGTSERGSDVASAQLPNFRHALVVFGGLQGLEAGADADPNLEVAEPSVLFDLYVNTCPGQGSRTIRTEEAILISLAALQPGLIQAGARHT | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
39 | Acetylation | KKKWKDLKLMKKLER HHHHHHHHHHHHHHH | 57.58 | 30587365 | |
66 | Ubiquitination | EEEAAAEKEDRGRPY HHHHHHHHHHCCCCE | 61.25 | 21906983 | |
66 | Acetylation | EEEAAAEKEDRGRPY HHHHHHHHHHCCCCE | 61.25 | 26051181 | |
82 | Phosphorylation | LSVALPGSILDNAQS EEEECCCHHHHCCCC | 20.31 | 17081983 | |
123 | Sumoylation | DEEGQDAKTVEGEFT CCCCCCCEEEEEEEE | 62.48 | - | |
134 | Ubiquitination | GEFTGVGKKGQACVQ EEEECCCCHHHHHHH | 51.85 | 29967540 | |
134 | Acetylation | GEFTGVGKKGQACVQ EEEECCCCHHHHHHH | 51.85 | 25953088 | |
135 | Ubiquitination | EFTGVGKKGQACVQL EEECCCCHHHHHHHH | 50.77 | 29967540 | |
148 | Ubiquitination | QLARILQYLECPQYL HHHHHHHHHHCHHHH | 10.87 | 21963094 | |
162 | Ubiquitination | LRKAFFPKHQDLQFA HHHHHCCCCCCCCCC | 49.06 | 29967540 | |
177 | Phosphorylation | GLLNPLDSPHHMRQD CCCCCCCCCCCCCCC | 33.54 | 28555341 | |
219 | Ubiquitination | KKEVKIDKNLEPGLR CCEEECCCCCCCCCE | 67.89 | 29967540 | |
240 | Ubiquitination | QQQHPDCKTYHGKVV CCCCCCCCEECEEEC | 60.54 | - | |
241 | Phosphorylation | QQHPDCKTYHGKVVS CCCCCCCEECEEECC | 27.38 | - | |
242 | Phosphorylation | QHPDCKTYHGKVVSS CCCCCCEECEEECCC | 8.28 | - | |
245 | Ubiquitination | DCKTYHGKVVSSQDP CCCEECEEECCCCCC | 26.59 | 29967540 | |
294 | Phosphorylation | IGTSERGSDVASAQL EECCCCCCCCHHHCC | 34.82 | 20068231 | |
298 | Phosphorylation | ERGSDVASAQLPNFR CCCCCCHHHCCCCCC | 19.18 | 20068231 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CI114_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CI114_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CI114_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NAF1_HUMAN | NAF1 | physical | 26472758 | |
DKC1_HUMAN | DKC1 | physical | 26472758 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...