| UniProt ID | CI114_HUMAN | |
|---|---|---|
| UniProt AC | Q5T280 | |
| Protein Name | Putative methyltransferase C9orf114 {ECO:0000305} | |
| Gene Name | SPOUT1 {ECO:0000312|HGNC:HGNC:26933} | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 376 | |
| Subcellular Localization | Cytoplasm, cytoskeleton, spindle . Chromosome, centromere, kinetochore . Cytoplasm, cytoskeleton, microtubule organizing center, centrosome . Associated with the outer kinetochore. | |
| Protein Description | Required for association of the centrosomes with the poles of the bipolar mitotic spindle during metaphase. [PubMed: 20813266] | |
| Protein Sequence | MAERGRKRPCGPGEHGQRIEWRKWKQQKKEEKKKWKDLKLMKKLERQRAQEEQAKRLEEEEAAAEKEDRGRPYTLSVALPGSILDNAQSPELRTYLAGQIARACAIFCVDEIVVFDEEGQDAKTVEGEFTGVGKKGQACVQLARILQYLECPQYLRKAFFPKHQDLQFAGLLNPLDSPHHMRQDEESEFREGIVVDRPTRPGHGSFVNCGMKKEVKIDKNLEPGLRVTVRLNQQQHPDCKTYHGKVVSSQDPRTKAGLYWGYTVRLASCLSAVFAEAPFQDGYDLTIGTSERGSDVASAQLPNFRHALVVFGGLQGLEAGADADPNLEVAEPSVLFDLYVNTCPGQGSRTIRTEEAILISLAALQPGLIQAGARHT | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 39 | Acetylation | KKKWKDLKLMKKLER HHHHHHHHHHHHHHH | 57.58 | 30587365 | |
| 66 | Ubiquitination | EEEAAAEKEDRGRPY HHHHHHHHHHCCCCE | 61.25 | 21906983 | |
| 66 | Acetylation | EEEAAAEKEDRGRPY HHHHHHHHHHCCCCE | 61.25 | 26051181 | |
| 82 | Phosphorylation | LSVALPGSILDNAQS EEEECCCHHHHCCCC | 20.31 | 17081983 | |
| 123 | Sumoylation | DEEGQDAKTVEGEFT CCCCCCCEEEEEEEE | 62.48 | - | |
| 134 | Ubiquitination | GEFTGVGKKGQACVQ EEEECCCCHHHHHHH | 51.85 | 29967540 | |
| 134 | Acetylation | GEFTGVGKKGQACVQ EEEECCCCHHHHHHH | 51.85 | 25953088 | |
| 135 | Ubiquitination | EFTGVGKKGQACVQL EEECCCCHHHHHHHH | 50.77 | 29967540 | |
| 148 | Ubiquitination | QLARILQYLECPQYL HHHHHHHHHHCHHHH | 10.87 | 21963094 | |
| 162 | Ubiquitination | LRKAFFPKHQDLQFA HHHHHCCCCCCCCCC | 49.06 | 29967540 | |
| 177 | Phosphorylation | GLLNPLDSPHHMRQD CCCCCCCCCCCCCCC | 33.54 | 28555341 | |
| 219 | Ubiquitination | KKEVKIDKNLEPGLR CCEEECCCCCCCCCE | 67.89 | 29967540 | |
| 240 | Ubiquitination | QQQHPDCKTYHGKVV CCCCCCCCEECEEEC | 60.54 | - | |
| 241 | Phosphorylation | QQHPDCKTYHGKVVS CCCCCCCEECEEECC | 27.38 | - | |
| 242 | Phosphorylation | QHPDCKTYHGKVVSS CCCCCCEECEEECCC | 8.28 | - | |
| 245 | Ubiquitination | DCKTYHGKVVSSQDP CCCEECEEECCCCCC | 26.59 | 29967540 | |
| 294 | Phosphorylation | IGTSERGSDVASAQL EECCCCCCCCHHHCC | 34.82 | 20068231 | |
| 298 | Phosphorylation | ERGSDVASAQLPNFR CCCCCCHHHCCCCCC | 19.18 | 20068231 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CI114_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CI114_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CI114_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| NAF1_HUMAN | NAF1 | physical | 26472758 | |
| DKC1_HUMAN | DKC1 | physical | 26472758 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...