| UniProt ID | CDT2_SCHPO | |
|---|---|---|
| UniProt AC | Q10990 | |
| Protein Name | Cell division cycle protein cdt2 | |
| Gene Name | cdt2 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 490 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Substrate-specific adapter of a DCX (DDB1-CUL4-X-box) E3 ubiquitin-protein ligase complex required for DNA replication during mitosis and meiosis. The DCX(DTL) complex, also named CRL4(CDT2) complex, mediates the polyubiquitination and subsequent degradation of cdt1 and spd1. Involved in the regulation of mitotic and pre-meiotic S-phase progression.. | |
| Protein Sequence | MNMDIGKALSDVGGLRDITSRANNSLPPTPDSSPAAPSKKHKLYDFLESRGKIETPRKRIVFEKKPLLHKPVHIQKKPAQLCKELLIRQLGGSRSHPFSTKTSRHVGGRLNLETYYSRPSECLMMLNQLPFCLGFANNESLLAVCTETGALELFDSRFYDRQNEENQPSARRIHGWLAHNNAIFSVNFSKDDSLLATSSGDQTSKVFDLSTQQCITRLGRRGVDGYHSHSVKQVNFCNDSPYNLVSCSRDGSIIFWDMRTHGITIDGEHFQKPVLRIRKAHENSGRDCSITSATWLPQSTSQVISSCSANSALKLWDLRTVHTVRPLPAATTPELTTSKRDFGVTNVCTSPDGERIYAASRDSIIYEYSSRHLNSGFCKTYKDPRLRISSFYVKLACSPDGATLACGGGVQDKTSGVVVFDTTRNCSSSAMLTGGHTKDVTAVDWSSEGQLASISDDGSVRVWNSSLHGSAANLREKNFSEIFYWGFSEK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 25 | Phosphorylation | ITSRANNSLPPTPDS HHHHCCCCCCCCCCC | 41.90 | 25720772 | |
| 29 | Phosphorylation | ANNSLPPTPDSSPAA CCCCCCCCCCCCCCC | 37.48 | 25720772 | |
| 32 | Phosphorylation | SLPPTPDSSPAAPSK CCCCCCCCCCCCCCC | 39.15 | 25720772 | |
| 33 | Phosphorylation | LPPTPDSSPAAPSKK CCCCCCCCCCCCCCC | 26.41 | 25720772 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CDT2_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CDT2_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CDT2_SCHPO !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
