PSK1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PSK1_SCHPO
• UniProt AC: Q12706
• Protein Name: Serine/threonine-protein kinase psk1 {ECO:0000303|PubMed:8529881}
• Gene Name: psk1 {ECO:0000303|PubMed:8529881}
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 436
• Subcellular Localization: Cytoplasm .
• Protein Description: AGC kinase which plays a role in TOR complex 1 (TORC1) signaling pathway which mediates temporal control of cell growth in response to nutrients. Required for phosphorylation of ribosomal protein S6 (rps601/rps602) at 'Ser-235' and 'Ser-236'..
• Protein Sequence: MPVFMFDEHDNLNENYNSHLSSDDEIAEEGYDFEELEASASTITSSSDLKDGKNAKDEKGTVEFKVAAHGDFISSKGDNYVPSGKMRPADFQPLTVLGRGSYGKVLLVKQKNTGRLFAQKQLKKASIVLRAKGLEQTKNERQILEEVRHPFICRLYYAFQDHDRLYLILQYAPGGELFSHLAEQRMLPEDVVAFYTAELTLALIHLHKLGIVYRDLKPENCLLDAEGHILLTDFGLSKVAENGADCRSFVGTEEYCAPEILLEQPYDHAVDWWSMGILIFDLLTGSPPFTANNHKRIMEKITRAKPNIPFYVTSDARDIINKFLKKNPKQRLGADGPEKGYDAIKKHRIYRRIDWNKLEKRMLPPPIVPCITNPEAAENFSVEFTKLPLSTTPILHEEFGNLTIGSHSSAFQGFTYVASPNFLNCEFLSNNAVSNH

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
102	Phosphorylation	TVLGRGSYGKVLLVK EEEECCCCCEEEEEE	24.64	-
248	Phosphorylation	ENGADCRSFVGTEEY HCCCCCHHHCCCCCC	30.52	22976295
392	Phosphorylation	TKLPLSTTPILHEEF EECCCCCCCCEEHHH	12.64	22976295
415	Phosphorylation	SSAFQGFTYVASPNF CCCCCCCEEEECCCC	24.74	22976295

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
248	S	Phosphorylation	Kinase	KSG1	Q12701	Uniprot
392	T	Phosphorylation	Kinase	TORC1	-	Uniprot
415	T	Phosphorylation	Kinase	TORC1	-	Uniprot

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PSK1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PSK1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RS6B_SCHPO	rps602	physical	22976295

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.