| UniProt ID | LAF1_SCHPO | |
|---|---|---|
| UniProt AC | O13719 | |
| Protein Name | SWIRM domain-containing protein laf1 | |
| Gene Name | laf1 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 297 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Component of the RPD3C(L) histone deacetylase complex (HDAC) responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events.. | |
| Protein Sequence | MKSSQTLVYSIPRNVEKDTCAAAIKAYQYLISPPPSPIPNDKVASTVDVPKCSTIPESPKDSIVEPKPTATPVAQLHSKVYDLYRDSPKIWLRRERQWLQRHSPAYRFSTPAAKRPRRQPSSFLDVHASNTRKRGSPDTPDSGHSTPHSKGDVHPGMPQHNTRFKQSSREFSSNTQAIDVANTPYELLPDYSPDMSVLDKRSHPRPLRSEWKGPPLDLSNDENRHLLHPAELQLAATLRLPCLVYLDNKRRIFAEWHNRRTQGLSFRKTDAQRASRVDVNKASRLWKAFHDEGFFDD | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 29 | Phosphorylation | AAIKAYQYLISPPPS HHHHHHHHHHCCCCC | 29996109 | ||
| 32 | Phosphorylation | KAYQYLISPPPSPIP HHHHHHHCCCCCCCC | 24763107 | ||
| 36 | Phosphorylation | YLISPPPSPIPNDKV HHHCCCCCCCCCCCC | 24763107 | ||
| 58 | Phosphorylation | KCSTIPESPKDSIVE CCCCCCCCCCCCCCC | 27738172 | ||
| 136 | Phosphorylation | SNTRKRGSPDTPDSG CCCCCCCCCCCCCCC | 21712547 | ||
| 139 | Phosphorylation | RKRGSPDTPDSGHST CCCCCCCCCCCCCCC | 24763107 | ||
| 142 | Phosphorylation | GSPDTPDSGHSTPHS CCCCCCCCCCCCCCC | 21712547 | ||
| 145 | Phosphorylation | DTPDSGHSTPHSKGD CCCCCCCCCCCCCCC | 24763107 | ||
| 146 | Phosphorylation | TPDSGHSTPHSKGDV CCCCCCCCCCCCCCC | 29996109 | ||
| 149 | Phosphorylation | SGHSTPHSKGDVHPG CCCCCCCCCCCCCCC | 21712547 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LAF1_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LAF1_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LAF1_SCHPO !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
