UniProt ID | SET6_SCHPO | |
---|---|---|
UniProt AC | O94256 | |
Protein Name | SET domain and MYND-type zinc finger protein 6 | |
Gene Name | set6 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 483 | |
Subcellular Localization | Cytoplasm . Nucleus . Localizes to chromatin. | |
Protein Description | ||
Protein Sequence | MDAPLIASVILPEFGKGTVATDNIPIGKIIIRKRVDILSLDSANLTRTCSTCTEEKVKTQRCAACKIIHYCSKGCQKADWPFHKLECKALQASKQNGILPSVCRLLIRLYLLWQKNPAIIEPMEGHQNEFQAVSSSWSDAELIASAASHYTQIYQAELFQKLFCRLAVNAMNLVTSSFDSLGMCLDTILCRLNHSCDPNCQIIFDGAIVQLVSKRDIKKDEQLFISYIDIRLPKSIRQKQLLKKYFFSCYCPRCENDHTTKETDGSKWMGRLRNSKSLMKNLAMARDLWSCGWKQTAFPWSNLLHHIKLGMLDESNFNGAFAALYLKSSADEFLDALHVVDEYQLLLLGKQVAMEVKHLMFPNDKPLEMEFPSSSQPQQTVPTNNSLFLLKNIPSFGGLHHCILGRYSISLDDFVLWLLDRAQRLQQAVRISHPSTTFCSNVENDIKEIFEVCKDYCMLHVQNNLKAFEEKLWAACKDFLVTY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of SET6_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SET6_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SET6_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SET6_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ASL1_SCHPO | asl1 | genetic | 22681890 | |
MPH1L_SCHPO | mph1 | genetic | 22681890 | |
HRP3_SCHPO | hrp3 | genetic | 22681890 | |
YE88_SCHPO | SPAC9G1.08c | genetic | 22681890 | |
YEG3_SCHPO | pcf2 | genetic | 22681890 | |
MGR2_SCHPO | mgr2 | genetic | 22681890 | |
YE08_SCHPO | SPAC17H9.08 | genetic | 22681890 | |
YGWH_SCHPO | gmh4 | genetic | 22681890 | |
ERG5_SCHPO | erg5 | genetic | 22681890 | |
YDQ4_SCHPO | SPAC5D6.04 | genetic | 22681890 | |
YD58_SCHPO | nas6 | genetic | 22681890 | |
YFM8_SCHPO | SPAC222.08c | genetic | 22681890 | |
RL16B_SCHPO | rpl1601 | genetic | 22681890 | |
PPK16_SCHPO | ppk16 | genetic | 22681890 | |
CGM2_SCHPO | mcs2 | genetic | 22681890 | |
TBA2_SCHPO | atb2 | genetic | 22681890 | |
PRZ1_SCHPO | prz1 | genetic | 22681890 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...