dbPTM

CSN4_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CSN4_SCHPO
UniProt AC	O13895
Protein Name	COP9 signalosome complex subunit 4
Gene Name	csn4
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	377
Subcellular Localization	Cytoplasm . Nucleus .
Protein Description	Component of the COP9 signalosome (CSN) complex that acts as an regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunit of SCF-type E3 ubiquitin-protein ligase complexes..
Protein Sequence	MEEVVHYFLEGNMPVAQFREALALHYTNEKELFEQAKRCLNICCGSNNFAKRNDVLFSLLDVAVSISSLELRKELISELYVPVQSLEEAPSEYLVSCCLQLATIYEAEQNFELLCSSLEAVEKHGHFENDLEQLLLLRIRLGDAYLKLGKAEKAILTVRTSIPLAFKVSNDQLLMELQLCNARALDETGQFLEAAKCYYRVLQYKVPGNELIYRENLCSVAQCLLLAIPSPIVLQFLQEISLQPSVREIPFYSLVEKYLKRKFIGKEDGAFLLPFLLPHQVIHMNRLIEDGRHFLETNILFLSEFFEVSSTSILAKHFKLSEEQVDTVVADMVIQERLNASIDQCEGYITFLPEYGKANNLPNYVNKIATVLQHYGS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of CSN4_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of CSN4_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CSN4_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CSN4_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CSN2_SCHPO	csn2	physical	11854407
CUL3_SCHPO	cul3	physical	11504566
IDHP_SCHPO	idp1	genetic	22681890
NSE6_SCHPO	nse6	genetic	22681890
YGRG_SCHPO	SPBC365.16	genetic	22681890
YJB1_SCHPO	dbl2	genetic	22681890
YAS5_SCHPO	mms1	genetic	22681890
MCL1_SCHPO	mcl1	genetic	22681890
OMH6_SCHPO	omh6	genetic	22681890

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CSN4_SCHPO

Related Literatures of Post-Translational Modification