| UniProt ID | YBX5_SCHPO | |
|---|---|---|
| UniProt AC | Q10203 | |
| Protein Name | Uncharacterized protein C17D1.05 | |
| Gene Name | SPBC17D1.05 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 368 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MSFVDGVNSWFSAASYWDGLGPTNVVQPEDDLAFVSQFEEVESAYDNLVKNGMIAPRRKNSFASSVNNPFSTSALSEALNGSVSMSHVPSSGLLKSTLSSTPTAGSNLLGTSPAEPASGLVGSSGFGSSMLGSSLPGNATSNFGSQASTSLLHPRRSTTSLLSSSAHHSRSSYYDLATPTRSSFSYNTVGAASLPSGGLSNLSSSLRSSSKSAGFSLFESASNSFTPSSFIESANMESLSIPSRRRPSSIAPIGTRPSRKEIAFSNSSTPTDQTLRPPNPPAANGNATPVTAVNNVSAVADSPQSTGSSVSSSLPTLSLDFKQEYSGNNHDMSGLSSSLSKSHNSTSALSSQIWSSPCASTLGGVNVW | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 61 | Phosphorylation | IAPRRKNSFASSVNN CCCCCCCCCHHHCCC | 25.81 | 25720772 | |
| 64 | Phosphorylation | RRKNSFASSVNNPFS CCCCCCHHHCCCCCC | 32.57 | 21712547 | |
| 65 | Phosphorylation | RKNSFASSVNNPFST CCCCCHHHCCCCCCH | 25.99 | 25720772 | |
| 84 | Phosphorylation | EALNGSVSMSHVPSS HHHCCCCCCCCCCCC | 19.10 | 27738172 | |
| 90 | Phosphorylation | VSMSHVPSSGLLKST CCCCCCCCCCCCCHH | 35.63 | 27738172 | |
| 96 | Phosphorylation | PSSGLLKSTLSSTPT CCCCCCCHHHCCCCC | 34.25 | 27738172 | |
| 111 | Phosphorylation | AGSNLLGTSPAEPAS CCCCCCCCCCCCCCC | 31.35 | 27738172 | |
| 133 | Phosphorylation | FGSSMLGSSLPGNAT CCHHHCCCCCCCCCC | 25.41 | 27738172 | |
| 134 | Phosphorylation | GSSMLGSSLPGNATS CHHHCCCCCCCCCCC | 36.46 | 27738172 | |
| 157 | Phosphorylation | SLLHPRRSTTSLLSS CCCCCCCCCHHHHHH | 37.00 | 28889911 | |
| 158 | Phosphorylation | LLHPRRSTTSLLSSS CCCCCCCCHHHHHHC | 20.70 | 25720772 | |
| 159 | Phosphorylation | LHPRRSTTSLLSSSA CCCCCCCHHHHHHCC | 20.72 | 29996109 | |
| 160 | Phosphorylation | HPRRSTTSLLSSSAH CCCCCCHHHHHHCCC | 27.66 | 28889911 | |
| 163 | Phosphorylation | RSTTSLLSSSAHHSR CCCHHHHHHCCCCCC | 27.78 | 29996109 | |
| 164 | Phosphorylation | STTSLLSSSAHHSRS CCHHHHHHCCCCCCC | 31.36 | 25720772 | |
| 165 | Phosphorylation | TTSLLSSSAHHSRSS CHHHHHHCCCCCCCC | 28.39 | 25720772 | |
| 169 | Phosphorylation | LSSSAHHSRSSYYDL HHHCCCCCCCCCCCC | 24.80 | 25720772 | |
| 171 | Phosphorylation | SSAHHSRSSYYDLAT HCCCCCCCCCCCCCC | 26.21 | 29996109 | |
| 172 | Phosphorylation | SAHHSRSSYYDLATP CCCCCCCCCCCCCCC | 26.97 | 29996109 | |
| 173 | Phosphorylation | AHHSRSSYYDLATPT CCCCCCCCCCCCCCC | 11.40 | 25720772 | |
| 178 | Phosphorylation | SSYYDLATPTRSSFS CCCCCCCCCCCCCCC | 32.27 | 29996109 | |
| 185 | Phosphorylation | TPTRSSFSYNTVGAA CCCCCCCCCCCCCCC | 21.30 | 25720772 | |
| 186 | Phosphorylation | PTRSSFSYNTVGAAS CCCCCCCCCCCCCCC | 16.91 | 25720772 | |
| 193 | Phosphorylation | YNTVGAASLPSGGLS CCCCCCCCCCCCCHH | 40.03 | 29996109 | |
| 196 | Phosphorylation | VGAASLPSGGLSNLS CCCCCCCCCCHHHHH | 51.27 | 27738172 | |
| 203 | Phosphorylation | SGGLSNLSSSLRSSS CCCHHHHHHHHHHCC | 23.33 | 25720772 | |
| 204 | Phosphorylation | GGLSNLSSSLRSSSK CCHHHHHHHHHHCCC | 36.24 | 25720772 | |
| 205 | Phosphorylation | GLSNLSSSLRSSSKS CHHHHHHHHHHCCCC | 25.15 | 29996109 | |
| 208 | Phosphorylation | NLSSSLRSSSKSAGF HHHHHHHHCCCCCCC | 44.23 | 25720772 | |
| 209 | Phosphorylation | LSSSLRSSSKSAGFS HHHHHHHCCCCCCCH | 35.04 | 25720772 | |
| 248 | Phosphorylation | IPSRRRPSSIAPIGT CCCCCCCCCCCCCCC | 32.34 | 25720772 | |
| 249 | Phosphorylation | PSRRRPSSIAPIGTR CCCCCCCCCCCCCCC | 26.00 | 25720772 | |
| 255 | Phosphorylation | SSIAPIGTRPSRKEI CCCCCCCCCCCCCCE | 39.88 | 29996109 | |
| 333 | Phosphorylation | SGNNHDMSGLSSSLS CCCCCCCCCCHHHHH | 42.51 | 29996109 | |
| 336 | Phosphorylation | NHDMSGLSSSLSKSH CCCCCCCHHHHHHHC | 22.77 | 21712547 | |
| 337 | Phosphorylation | HDMSGLSSSLSKSHN CCCCCCHHHHHHHCC | 40.10 | 21712547 | |
| 338 | Phosphorylation | DMSGLSSSLSKSHNS CCCCCHHHHHHHCCC | 33.03 | 24763107 | |
| 340 | Phosphorylation | SGLSSSLSKSHNSTS CCCHHHHHHHCCCCH | 33.78 | 25720772 | |
| 342 | Phosphorylation | LSSSLSKSHNSTSAL CHHHHHHHCCCCHHH | 25.24 | 25720772 | |
| 345 | Phosphorylation | SLSKSHNSTSALSSQ HHHHHCCCCHHHHHH | 20.51 | 27738172 | |
| 346 | Phosphorylation | LSKSHNSTSALSSQI HHHHCCCCHHHHHHH | 24.28 | 25720772 | |
| 356 | Phosphorylation | LSSQIWSSPCASTLG HHHHHHCCCCHHHCC | 14.70 | 27738172 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YBX5_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YBX5_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YBX5_SCHPO !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of YBX5_SCHPO !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...