UniProt ID | NMES1_HUMAN | |
---|---|---|
UniProt AC | Q9C002 | |
Protein Name | Normal mucosa of esophagus-specific gene 1 protein | |
Gene Name | NMES1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 83 | |
Subcellular Localization | Nucleus . | |
Protein Description | ||
Protein Sequence | MSFFQLLMKRKELIPLVVFMTVAAGGASSFAVYSLWKTDVILDRKKNPEPWETVDPTVPQKLITINQQWKPIEELQNVQRVTK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
9 | Acetylation | SFFQLLMKRKELIPL CHHHHHHHHHHHHHH | 61.36 | 25038526 | |
38 | O-linked_Glycosylation | AVYSLWKTDVILDRK HHHHHHCCCEEECCC | 24.74 | 55826751 | |
53 | O-linked_Glycosylation | KNPEPWETVDPTVPQ CCCCCCCCCCCCCCC | 26.75 | 55833419 | |
57 | O-linked_Glycosylation | PWETVDPTVPQKLIT CCCCCCCCCCCCEEE | 40.11 | 55833423 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NMES1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NMES1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NMES1_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...