UniProt ID | NDK3_HUMAN | |
---|---|---|
UniProt AC | Q13232 | |
Protein Name | Nucleoside diphosphate kinase 3 | |
Gene Name | NME3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 169 | |
Subcellular Localization | ||
Protein Description | Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Probably has a role in normal hematopoiesis by inhibition of granulocyte differentiation and induction of apoptosis.. | |
Protein Sequence | MICLVLTIFANLFPAACTGAHERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYAELRERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVESARREIALWFRADELLCWEDSAGHWLYE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
29 | Ubiquitination | ERTFLAVKPDGVQRR CCEEEEECCCCHHHH | 31.61 | 22817900 | |
29 | Acetylation | ERTFLAVKPDGVQRR CCEEEEECCCCHHHH | 31.61 | 27452117 | |
35 | Methylation | VKPDGVQRRLVGEIV ECCCCHHHHHHHHHH | 31.34 | 24387917 | |
48 | Ubiquitination | IVRRFERKGFKLVAL HHHHHHHCCCHHHHH | 62.59 | 22817900 | |
51 | Ubiquitination | RFERKGFKLVALKLV HHHHCCCHHHHHHHH | 51.20 | 21890473 | |
56 | Ubiquitination | GFKLVALKLVQASEE CCHHHHHHHHHHCHH | 36.55 | 22817900 | |
61 | Phosphorylation | ALKLVQASEELLREH HHHHHHHCHHHHHHH | 17.95 | 22817900 | |
69 | Phosphorylation | EELLREHYAELRERP HHHHHHHHHHHHHCC | 9.30 | - | |
111 | Phosphorylation | SRALIGATNPADAPP HHHHHCCCCCCCCCC | 36.20 | 27050516 | |
137 | Phosphorylation | GKNLIHGSDSVESAR CCCEECCCCCHHHHH | 16.73 | 23312004 | |
139 | Phosphorylation | NLIHGSDSVESARRE CEECCCCCHHHHHHH | 29.49 | 23312004 | |
142 | Phosphorylation | HGSDSVESARREIAL CCCCCHHHHHHHHHH | 25.56 | 23312004 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NDK3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NDK3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NDK3_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SGTA_HUMAN | SGTA | physical | 16189514 | |
NDKB_HUMAN | NME2 | physical | 16169070 | |
NDKA_HUMAN | NME1 | physical | 11042679 | |
NDKB_HUMAN | NME2 | physical | 11042679 | |
A4_HUMAN | APP | physical | 21832049 | |
SGTA_HUMAN | SGTA | physical | 25416956 | |
UBQL1_HUMAN | UBQLN1 | physical | 25416956 | |
NDKB_HUMAN | NME2 | physical | 28514442 | |
BBS5_HUMAN | BBS5 | physical | 28514442 | |
PTHB1_HUMAN | BBS9 | physical | 28514442 | |
NDKM_HUMAN | NME4 | physical | 28514442 | |
BBS4_HUMAN | BBS4 | physical | 28514442 | |
TTC8_HUMAN | TTC8 | physical | 28514442 | |
EXD2_HUMAN | EXD2 | physical | 28514442 | |
BBS7_HUMAN | BBS7 | physical | 28514442 | |
BBS2_HUMAN | BBS2 | physical | 28514442 | |
NDKA_HUMAN | NME1 | physical | 28514442 | |
PEX14_HUMAN | PEX14 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...