| UniProt ID | NDK3_HUMAN | |
|---|---|---|
| UniProt AC | Q13232 | |
| Protein Name | Nucleoside diphosphate kinase 3 | |
| Gene Name | NME3 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 169 | |
| Subcellular Localization | ||
| Protein Description | Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Probably has a role in normal hematopoiesis by inhibition of granulocyte differentiation and induction of apoptosis.. | |
| Protein Sequence | MICLVLTIFANLFPAACTGAHERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYAELRERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVESARREIALWFRADELLCWEDSAGHWLYE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 29 | Ubiquitination | ERTFLAVKPDGVQRR CCEEEEECCCCHHHH | 31.61 | 22817900 | |
| 29 | Acetylation | ERTFLAVKPDGVQRR CCEEEEECCCCHHHH | 31.61 | 27452117 | |
| 35 | Methylation | VKPDGVQRRLVGEIV ECCCCHHHHHHHHHH | 31.34 | 24387917 | |
| 48 | Ubiquitination | IVRRFERKGFKLVAL HHHHHHHCCCHHHHH | 62.59 | 22817900 | |
| 51 | Ubiquitination | RFERKGFKLVALKLV HHHHCCCHHHHHHHH | 51.20 | 21890473 | |
| 56 | Ubiquitination | GFKLVALKLVQASEE CCHHHHHHHHHHCHH | 36.55 | 22817900 | |
| 61 | Phosphorylation | ALKLVQASEELLREH HHHHHHHCHHHHHHH | 17.95 | 22817900 | |
| 69 | Phosphorylation | EELLREHYAELRERP HHHHHHHHHHHHHCC | 9.30 | - | |
| 111 | Phosphorylation | SRALIGATNPADAPP HHHHHCCCCCCCCCC | 36.20 | 27050516 | |
| 137 | Phosphorylation | GKNLIHGSDSVESAR CCCEECCCCCHHHHH | 16.73 | 23312004 | |
| 139 | Phosphorylation | NLIHGSDSVESARRE CEECCCCCHHHHHHH | 29.49 | 23312004 | |
| 142 | Phosphorylation | HGSDSVESARREIAL CCCCCHHHHHHHHHH | 25.56 | 23312004 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NDK3_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NDK3_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NDK3_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| SGTA_HUMAN | SGTA | physical | 16189514 | |
| NDKB_HUMAN | NME2 | physical | 16169070 | |
| NDKA_HUMAN | NME1 | physical | 11042679 | |
| NDKB_HUMAN | NME2 | physical | 11042679 | |
| A4_HUMAN | APP | physical | 21832049 | |
| SGTA_HUMAN | SGTA | physical | 25416956 | |
| UBQL1_HUMAN | UBQLN1 | physical | 25416956 | |
| NDKB_HUMAN | NME2 | physical | 28514442 | |
| BBS5_HUMAN | BBS5 | physical | 28514442 | |
| PTHB1_HUMAN | BBS9 | physical | 28514442 | |
| NDKM_HUMAN | NME4 | physical | 28514442 | |
| BBS4_HUMAN | BBS4 | physical | 28514442 | |
| TTC8_HUMAN | TTC8 | physical | 28514442 | |
| EXD2_HUMAN | EXD2 | physical | 28514442 | |
| BBS7_HUMAN | BBS7 | physical | 28514442 | |
| BBS2_HUMAN | BBS2 | physical | 28514442 | |
| NDKA_HUMAN | NME1 | physical | 28514442 | |
| PEX14_HUMAN | PEX14 | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...