UniProt ID | HEBP1_HUMAN | |
---|---|---|
UniProt AC | Q9NRV9 | |
Protein Name | Heme-binding protein 1 | |
Gene Name | HEBP1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 189 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | May bind free porphyrinogens that may be present in the cell and thus facilitate removal of these potentially toxic compound. Binds with a high affinity to one molecule of heme or porphyrins. It binds metalloporphyrins, free porphyrins and N-methylprotoporphyrin with similar affinities.. | |
Protein Sequence | MLGMIKNSLFGSVETWPWQVLSKGDKEEVAYEERACEGGKFATVEVTDKPVDEALREAMPKVAKYAGGTNDKGIGMGMTVPISFAVFPNEDGSLQKKLKVWFRIPNQFQSDPPAPSDKSVKIEEREGITVYSMQFGGYAKEADYVAQATRLRAALEGTATYRGDIYFCTGYDPPMKPYGRRNEIWLLKT | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
12 | Phosphorylation | IKNSLFGSVETWPWQ CCCCCCCCCCCCCCE | 14.94 | 28348404 | |
15 | Phosphorylation | SLFGSVETWPWQVLS CCCCCCCCCCCEEEE | 34.37 | 24719451 | |
40 | 2-Hydroxyisobutyrylation | ERACEGGKFATVEVT EHHHCCCCEEEEEEC | 42.56 | - | |
40 | Acetylation | ERACEGGKFATVEVT EHHHCCCCEEEEEEC | 42.56 | 26051181 | |
40 | Ubiquitination | ERACEGGKFATVEVT EHHHCCCCEEEEEEC | 42.56 | - | |
49 | Ubiquitination | ATVEVTDKPVDEALR EEEEECCCCHHHHHH | 37.26 | 21906983 | |
64 | Ubiquitination | EAMPKVAKYAGGTND HHCHHHHHHCCCCCC | 38.32 | - | |
96 | Ubiquitination | NEDGSLQKKLKVWFR CCCCCHHEEEEEEEE | 66.42 | - | |
110 | Phosphorylation | RIPNQFQSDPPAPSD ECCCCCCCCCCCCCC | 54.06 | 27251275 | |
118 | Ubiquitination | DPPAPSDKSVKIEER CCCCCCCCCCEEEEE | 62.58 | 21906983 | |
121 | Acetylation | APSDKSVKIEEREGI CCCCCCCEEEEECCE | 52.03 | 7671075 | |
121 | Ubiquitination | APSDKSVKIEEREGI CCCCCCCEEEEECCE | 52.03 | - | |
129 | Phosphorylation | IEEREGITVYSMQFG EEEECCEEEEEEEEC | 25.01 | 21406692 | |
131 | Phosphorylation | EREGITVYSMQFGGY EECCEEEEEEEECCH | 6.97 | 21406692 | |
132 | Phosphorylation | REGITVYSMQFGGYA ECCEEEEEEEECCHH | 11.19 | 21406692 | |
138 | Phosphorylation | YSMQFGGYAKEADYV EEEEECCHHHHHHHH | 18.19 | 21406692 | |
144 | Phosphorylation | GYAKEADYVAQATRL CHHHHHHHHHHHHHH | 12.53 | 22817900 | |
175 | Sulfoxidation | CTGYDPPMKPYGRRN EECCCCCCCCCCCCC | 9.21 | 30846556 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HEBP1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HEBP1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HEBP1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
COTL1_HUMAN | COTL1 | physical | 26344197 | |
PCBP1_HUMAN | PCBP1 | physical | 26344197 | |
S10A6_HUMAN | S100A6 | physical | 26344197 | |
SNX3_HUMAN | SNX3 | physical | 26344197 | |
UB2L3_HUMAN | UBE2L3 | physical | 26344197 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...