UniProt ID | 14333_ARATH | |
---|---|---|
UniProt AC | P42644 | |
Protein Name | 14-3-3-like protein GF14 psi {ECO:0000303|PubMed:7972511} | |
Gene Name | GRF3 {ECO:0000303|PubMed:7870824} | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 255 | |
Subcellular Localization | Cytoplasm . Nucleus . Translocates from the cytosol to the nucleus when phosphorylated. | |
Protein Description | Is associated with a DNA binding complex that binds to the G box, a well-characterized cis-acting DNA regulatory element found in plant genes. [PubMed: 7972511] | |
Protein Sequence | MSTREENVYMAKLAEQAERYEEMVEFMEKVAKTVDVEELSVEERNLLSVAYKNVIGARRASWRIISSIEQKEESKGNEDHVAIIKDYRGKIESELSKICDGILNVLEAHLIPSASPAESKVFYLKMKGDYHRYLAEFKAGAERKEAAESTLVAYKSASDIATAELAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDDAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMTDEAGDEIKEASKPDGAE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSTREENVY ------CCHHHHHHH | 35.85 | 25561503 | |
3 | Phosphorylation | -----MSTREENVYM -----CCHHHHHHHH | 40.58 | 25561503 | |
9 | Phosphorylation | STREENVYMAKLAEQ CHHHHHHHHHHHHHH | 11.70 | 25561503 | |
48 | Phosphorylation | VEERNLLSVAYKNVI HHHHHHHHHHHHHHH | 14.10 | 25561503 | |
66 | Phosphorylation | RASWRIISSIEQKEE HHHHHHHHHHHHHHH | 23.92 | - | |
156 | Phosphorylation | STLVAYKSASDIATA HHHHEECCHHHHHCC | 21.96 | 25561503 | |
158 | Phosphorylation | LVAYKSASDIATAEL HHEECCHHHHHCCCC | 36.32 | 25561503 | |
162 | Phosphorylation | KSASDIATAELAPTH CCHHHHHCCCCCCCC | 22.46 | 22092075 | |
189 | Phosphorylation | FYYEILNSPDRACSL HHHHHHCCHHHHHHH | 25.40 | - | |
210 | Phosphorylation | DAIAELDTLGEESYK HHHHHHHCCCCHHHC | 49.65 | - | |
231 | Phosphorylation | QLLRDNLTLWTSDMT HHHHCCCCEEECCCC | 26.89 | 23776212 | |
231 (in isoform 2) | Phosphorylation | - | 26.89 | 23776212 | |
234 | Phosphorylation | RDNLTLWTSDMTDEA HCCCCEEECCCCCHH | 20.26 | 23776212 | |
234 (in isoform 2) | Phosphorylation | - | 20.26 | 23776212 | |
235 | Phosphorylation | DNLTLWTSDMTDEAG CCCCEEECCCCCHHH | 17.50 | 23776212 | |
235 (in isoform 2) | Phosphorylation | - | 17.50 | 23776212 | |
238 | Phosphorylation | TLWTSDMTDEAGDEI CEEECCCCCHHHHHH | 35.36 | 30291188 | |
238 (in isoform 2) | Phosphorylation | - | 35.36 | 23776212 | |
240 (in isoform 2) | Phosphorylation | - | 45.44 | 23776212 | |
248 (in isoform 2) | Phosphorylation | - | 20.18 | 23776212 | |
249 | Phosphorylation | GDEIKEASKPDGAE- HHHHHHHHCCCCCC- | 45.90 | 23776212 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of 14333_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of 14333_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of 14333_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Large-scale Arabidopsis phosphoproteome profiling reveals novelchloroplast kinase substrates and phosphorylation networks."; Reiland S., Messerli G., Baerenfaller K., Gerrits B., Endler A.,Grossmann J., Gruissem W., Baginsky S.; Plant Physiol. 150:889-903(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-238, AND MASSSPECTROMETRY. |