dbPTM

DNAJ6_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	DNAJ6_ARATH
UniProt AC	Q9FL54
Protein Name	Chaperone protein dnaJ 6
Gene Name	ATJ6
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	284
Subcellular Localization	Nucleus .
Protein Description	Have a continuous role in plant development probably in the structural organization of compartments..
Protein Sequence	MGRKKKSRASTTEEDEIEMDNAGPSSETSLYEVLGVERRATSQEIRKAYHKLALKLHPDKNQDDKEAKDKFQQLQKVISILGDEEKRAVYDQTGSIDDADIPGDAFENLRDFFRDMYKKVNEADIEEFEANYRGSESEKKDLLELFNKFKGKMNRLFCSMLCSDPKLDSHRFKDMLDEAIAAGEVKSSKAYEKWANKISETKPPTSPLRKRKKKKSAAKDSETDLCLMIAKRQEERKGKVDSMFSSLISRYGGDAEAEPTEEEFEAAQRRIESKRKPSKKSRGK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
199	Phosphorylation	EKWANKISETKPPTS HHHHHHHHCCCCCCC	40.60	25561503
201	Phosphorylation	WANKISETKPPTSPL HHHHHHCCCCCCCHH	41.90	27643528
205	Phosphorylation	ISETKPPTSPLRKRK HHCCCCCCCHHHHHH	52.05	23111157
206	Phosphorylation	SETKPPTSPLRKRKK HCCCCCCCHHHHHHH	27.93	23111157

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of DNAJ6_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of DNAJ6_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of DNAJ6_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of DNAJ6_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of DNAJ6_ARATH

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Large-scale Arabidopsis phosphoproteome profiling reveals novelchloroplast kinase substrates and phosphorylation networks."; Reiland S., Messerli G., Baerenfaller K., Gerrits B., Endler A.,Grossmann J., Gruissem W., Baginsky S.; Plant Physiol. 150:889-903(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-206, AND MASSSPECTROMETRY.	19376835 [Abstract]