dbPTM

GH33_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	GH33_ARATH
UniProt AC	O22190
Protein Name	Indole-3-acetic acid-amido synthetase GH3.3
Gene Name	GH3.3
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	595
Subcellular Localization
Protein Description	Catalyzes the synthesis of indole-3-acetic acid (IAA)-amino acid conjugates, providing a mechanism for the plant to cope with the presence of excess auxin. Strongly reactive with Glu, Gln, Trp, Asp, Ala, Leu, Phe, Gly, Tyr, Met, Ile and Val. Little or no product formation with His, Ser, Thr, Arg, Lys, or Cys. Also active on pyruvic and butyric acid analogs of IAA, PAA and the synthetic auxin naphthaleneacetic acid (NAA). The two chlorinated synthetic auxin herbicides 2,4-D and 3,6-dichloro-o-anisic acid (dicamba) cannot be used as substrates..
Protein Sequence	MTVDSALRSPMMHSPSTKDVKALRFIEEMTRNVDFVQKKVIREILSRNSDTEYLKRFGLKGFTDRKTFKTKVPVVIYDDLKPEIQRIANGDRSMILSSYPITEFLTSSGTSAGERKLMPTIDEDMDRRQLLYSLLMPVMNLYVPGLDKGKALYFLFVKTESKTPGGLPARPVLTSYYKSEQFKRRPNDPYNVYTSPNEAILCPDSSQSMYTQMLCGLLMRHEVLRLGAVFASGLLRAIGFLQTNWKELADDISTGTLSSRISDPAIKESMSKILTKPDQELADFITSVCGQDNSWEGIITKIWPNTKYLDVIVTGAMAQYIPMLEYYSGGLPMACTMYASSESYFGINLKPMCKPSEVSYTIMPNMAYFEFLPHHEVPTEKSELVELADVEVGKEYELVITTYAGLNRYRVGDILQVTGFYNSAPQFKFVRRKNVLLSIESDKTDEAELQSAVENASLLLGEQGTRVIEYTSYAETKTIPGHYVIYWELLVKDQTNPPNDEVMARCCLEMEESLNSVYRQSRVADKSIGPLEIRVVKNGTFEELMDYAISRGASINQYKVPRCVSFTPIMELLDSRVVSTHFSPALPHWSPERRR

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
503	Sulfoxidation	NPPNDEVMARCCLEM CCCCHHHHHHHHHHH	1.51	23289948
590	Phosphorylation	SPALPHWSPERRR-- CCCCCCCCCCCCC--	17.53	27643528

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of GH33_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of GH33_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of GH33_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of GH33_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of GH33_ARATH

Related Literatures of Post-Translational Modification