UniProt ID | GH33_ARATH | |
---|---|---|
UniProt AC | O22190 | |
Protein Name | Indole-3-acetic acid-amido synthetase GH3.3 | |
Gene Name | GH3.3 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 595 | |
Subcellular Localization | ||
Protein Description | Catalyzes the synthesis of indole-3-acetic acid (IAA)-amino acid conjugates, providing a mechanism for the plant to cope with the presence of excess auxin. Strongly reactive with Glu, Gln, Trp, Asp, Ala, Leu, Phe, Gly, Tyr, Met, Ile and Val. Little or no product formation with His, Ser, Thr, Arg, Lys, or Cys. Also active on pyruvic and butyric acid analogs of IAA, PAA and the synthetic auxin naphthaleneacetic acid (NAA). The two chlorinated synthetic auxin herbicides 2,4-D and 3,6-dichloro-o-anisic acid (dicamba) cannot be used as substrates.. | |
Protein Sequence | MTVDSALRSPMMHSPSTKDVKALRFIEEMTRNVDFVQKKVIREILSRNSDTEYLKRFGLKGFTDRKTFKTKVPVVIYDDLKPEIQRIANGDRSMILSSYPITEFLTSSGTSAGERKLMPTIDEDMDRRQLLYSLLMPVMNLYVPGLDKGKALYFLFVKTESKTPGGLPARPVLTSYYKSEQFKRRPNDPYNVYTSPNEAILCPDSSQSMYTQMLCGLLMRHEVLRLGAVFASGLLRAIGFLQTNWKELADDISTGTLSSRISDPAIKESMSKILTKPDQELADFITSVCGQDNSWEGIITKIWPNTKYLDVIVTGAMAQYIPMLEYYSGGLPMACTMYASSESYFGINLKPMCKPSEVSYTIMPNMAYFEFLPHHEVPTEKSELVELADVEVGKEYELVITTYAGLNRYRVGDILQVTGFYNSAPQFKFVRRKNVLLSIESDKTDEAELQSAVENASLLLGEQGTRVIEYTSYAETKTIPGHYVIYWELLVKDQTNPPNDEVMARCCLEMEESLNSVYRQSRVADKSIGPLEIRVVKNGTFEELMDYAISRGASINQYKVPRCVSFTPIMELLDSRVVSTHFSPALPHWSPERRR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GH33_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GH33_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GH33_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of GH33_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...