PDX2_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PDX2_ARATH
• UniProt AC: Q8LAD0
• Protein Name: Probable pyridoxal 5'-phosphate synthase subunit PDX2
• Gene Name: PDX2
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 255
• Subcellular Localization: Cytoplasm .
• Protein Description: Catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the biosynthesis of pyridoxal 5'-phosphate. The resulting ammonia molecule is channeled to the active site of PDX1. Involved in the indirect resistance to singlet oxygen-generating photosensitizers..
• Protein Sequence: MTVGVLALQGSFNEHIAALRRLGVQGVEIRKADQLLTVSSLIIPGGESTTMAKLAEYHNLFPALREFVKMGKPVWGTCAGLIFLADRAVGQKEGGQELVGGLDCTVHRNFFGSQIQSFEADILVPQLTSQEGGPETYRGVFIRAPAVLDVGPDVEVLADYPVPSNKVLYSSSTVQIQEEDALPETKVIVAVKQGNLLATAFHPELTADTRWHSYFIKMTKEIEQGASSSSSKTIVSVGETSAGPEPAKPDLPIFQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of PDX2_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PDX2_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PDX2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PDX2_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PDX11_ARATH	PDX1.1	physical	16766694
PDX13_ARATH	RSR4	physical	16766694

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.